... Moscow State Uiversity . ... Different wave function models and perturbations theory approximations are discussed, including the second Born one. ... Keldysh Institute of Applied Mathematics of RAS . DRIVER: Numerical investigation of aerodynamic and aeroacoustic charateristics of bluff aircraft elements and complex turbulent flows, design of better noise prediction tools for development of quieter aircrafts . ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>29) - hpc.msu.ru/ )

• MSU's HPC HISTORY | Moscow University Supercomputing Center
• APPLICATIONS: Plasma Physics | Moscow University Supercomputing Center
• APPLICATIONS: Inorganic Chemistry | Moscow University Supercomputing Center

... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Surface tension and dynamic contact angle analysis for liquid droplets . ... The method procedures are well established but still require high quality drop images to measure the surface tension automatically, what may be the problem in difficult experimental conditions. In this paper, the highly automated methods of surface tension and dynamic contact angle measurement are presented. ...

Еще в разделе: (Показать все результаты (>88) - imaging.cmc.msu.ru/ )

Running Apache on a heavily loaded web server, one often encounters problems related to the machine and OS configuration. ... Quick and detailed performance tuning hints for BSD-derived systems. ... Depending on the syntactic form of the TZ environment variable, these systems have several different algorithms to determine the local time zone (presumably compatible with something). ... This form delegates the knowledge of the time zone information to an external compiled zoneinfo file ( la BSD). ...

Еще в разделе: (Показать все результаты (>52) - neptun.sai.msu.ru/ )

• Apache module mod_expires
• Apache module mod_unique_id
• Apache module mod_mime_magic

Vol.30,1978 435 A remark on nonsymmetric compact Riemann By surfaces D~AR G~B~ Let G be a group of automorphisms of a compact Riemann surface of genus g > 1. ... Singerman Eves one of genus g ---- 17 and some others of higher genus. this note we classify all K-automorphism groups of compact Riemann surfaces of genus 7. ... Apart from isomorphic copies there exist exactly two nonsymmetric Riemarm surfaces of genus 2 g g < 7 whose group is a K-automorphism group. ...

Еще в разделе: (Показать все результаты (>50) - dfgm.math.msu.su/ )

• Кудрявцева Е.А. / Кафедра Дифференциальной геометрии и приложений /
• Фоменко А.Т. / Кафедра Дифференциальной геометрии и приложений /
• Научная работа / Кафедра Дифференциальной геометрии и приложений /

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>9) - lmmqsp.sinp.msu.ru/ )

... October 6, 15:00 15:40 . ... PDF [2.3б MB] October 6, 15:40 16:30 . Warren Skidmore (TMT), Reed Riddle (TMT), Angel Otarola (TMT), Sebastian Els (TMT), Tony Travouillon (TMT), Matthias Schoeck (TMT), R. Dahl (ISIS), D. Naylor (ISIS), R. Querel (ISIS) . The results of the characterization of precipitable water vapor (PWV) in the atmospheric column carried out in the context of identifying potential sites for the deployment of the Thirty Meter Telescope (TMT) are presented. ...

Еще в разделе: (Показать все результаты (>16) - site2010.sai.msu.ru/ )

Software Protection: How to Crack Programs, and Defend Against Cracking" In the first part of this course we will learn how to "crack" programs, i.e.how hackers break into software to extract secrets, remove license checks, etc. ... Learning about this type of computer security is important because many current systems are vulnerable to cracking attacks. ... The course will have practical homework exercises where you will crack small programs, and use tools to protect against cracking. ...

Еще в разделе: (Показать все результаты (>2) - master.cmc.msu.ru/ )

A program for automatic detection of aligned blocks in multiple protein alignment. Paste your alignment in fasta-format here: . ... The program works slow - it takes 8 seconds to process alignment of 6 sequences of length 500. The program's development is supported by Russian Foundation for Basic Research (grant 10-07-00685-a) and Ministry of Education and Science of the Russian Federation (State Contract No. 07.514.11.4006). ...

Еще в разделе: (Показать все результаты (>7) - mouse.belozersky.msu.ru/ )

• wLake algorithm description

... An implementation of this method known as the generalized marching algorithm is described in detail in [1] . ... Molar mass . ... Массовый момент . ... This subroutine performs row and column scalings to equilibrate (to balance) a real general matrix . Масштабирование матриц . ... Mass matrix . ... This set has fewer elements than $K$ has . ... Метод . The method for solving the problems in mechanics . ... Метод моментов . ... Модули диаграммы секущий и касательный . ... Concrete modulus . ...

Еще в разделе: (Показать все результаты (>34) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/15.htm
• http://num-anal.srcc.msu.su/eng_math/redict/17.htm
• http://num-anal.srcc.msu.su/eng_math/redict/3.htm

... DOI љ] . ... Surface Science 606 , 3-4 (2012), 394?400. ... Soldatov, E., Kislov, V., Gubin, S., Artemyev, M., Kisiel, D., Sergeev-Cherenkov, A., Pavlov, S., Trifonov, A., and Khomutov, G. Monomolecular polymeric films with incorporated au-101 clusters.љ ... Surface Science 532 (2003), 287?293. ... Obydenov, A., Gubin, S., Khanin, V., Polyakov, S., Sergeyev-Cherenkov, A., Soldatov, E., Trifonov, A., and Khomutov, G. Structure and properties of langmuir-blodgett films containing cluster molecules.љ ...

Еще в разделе: (Показать все результаты (>18) - cryolab.phys.msu.ru/ )

• Eugene S. Soldatov

... Head of the laboratory of amorphous and crystalline alloys of rare earth metals. ... Physics of magnetics, magnetic phase transitions, magnetic properties of rare earth compounds. ... Experimental study of the magnetic properties of rare earth alloys and compounds. ... Three-critical point on magnetic phase diagram was found in dysprosium and rare earth alloys. ... Giant magnetocaloric effect has been found in rare earth metals, Fe-Rh alloy and a series of intermetallic compounds. ...

Еще в разделе: (Показать все результаты (>21) - ferro.phys.msu.ru/ )

... Полная версия этой страницы: инетрнет-игры . Студенческий форум Физфака МГУ > Общий > Все обо всем > Спорт . ismolnik . 22.2.2007, 18:24 . ... you hold 160.11 seconds . ... На хороших скоростях - 31.285 секунд нервного напряжения . ... 3.828 seconds, . ... Без глюков - 12 секунд. ... Для просмотра полной версии этой страницы, пожалуйста, пройдите по ссылке . ...

Еще в разделе: (Показать все результаты (>247) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Quantum gravity corrects QED
• Студенческий форум Физфака МГУ > буржуйский пунк
• Quantum gravity corrects QED - Студенческий форум Физфака МГУ

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>110) - www.genebee.msu.ru/ )

• Picornaviruses: discovering big in small
• IGLA-3D User Guide
• AliComp - GeneBee Alignments Comparison - Advanced

1990k: 70007 70E99 (58F40, 76D25) Samsonov V.A., Shamolin M.V. On the problem of the motion of a body in a resisting medium (Russian). ... 70: Mechanics of particles and systems. 70E: Dynamics of rigid body. ... 58F: Ordinary differential equations on manifolds; dynamical systems. ... Russian. ... 34: Ordinary differential equations. ... As applications we consider dynamical systems that describe the plane-parallel motion of a body in a resisting medium as well as various model variants of it." ...

Еще в разделе: (Показать все результаты (>34) - shamolin2.imec.msu.ru/ )

... Printed in U.S.A. AN EXTRA LONG X-RAY PLATEAU IN A GAMMA-RAY BURST AND THE SPINAR PARADIGM V. Lipunov1, 2, 3 and E. Gorbovskoy 1, 2, 3 Received 2007 May 3; accepted 2007 June 25; published 2007 August 6 ABSTRACT The recently discovered gamma-ray burst GRB 070110 displayed an extraordinar y X-ray afterglow with Xray radiation--i.e., an X-ray ... 2006; Wang & Meszaros 2007). ... It is followed by a slow collapse (the magnetic field is weak), which results in a weak X-ray burst. ...

Еще в разделе: (Показать все результаты (>221) - observ.pereplet.ru/ )

• MASTER GLOBAL ROBOTIC TELESCOPES NET

... Place: Moscow State University (MSU), Universitetskii pr-t, 13, Moscow. ... SAI, Moscow ), Hanada H. (NAO, Mizusawa), Petrova N. (KSU, Kazan ), Zotov L. (SAI, Moscow ) Program of RJLPC Session I. The Moon : Kaguya mission Chair Barkin Yu.V. 10.00 - 10.30 H. Hanada (1), RISE team, RSAT/VRAD team, ILOM team (1) RISE Project, National Astronomical Observatory, Mizusawa, Oshu, Iwate, Japan The present status of KAGUYA (SELENE) and ILOM in RISE project 10.30 - 11.00 Matsumoto K. National ...

Еще в разделе: (Показать все результаты (>80) - sai.msu.ru/ )

• GCVS Research Group: Recent publications
• Конференции сайта АстрО
• General Catalogue of Variable Stars: Variability Types

... Студенческая жизнь . ... Russian Language Program . ... http://journals.cambridge.org/action/displayJournal?jid=aps . ... http://journals.cambridge.org/action/displayJournal?jid=bil . ... http://www.journals.elsevier.com/brain-and-language/ . ... http://journals.cambridge.org/action/displayJournal?jid=jcl . ... http://journals.cambridge.org/action/displayJournal?jid=lsy . ... http://journals.cambridge.org/action/displayJournal?jid=PHO . ... http://journals.cambridge.org/action/displayJournal?jid=SLA...

Еще в разделе: (Показать все результаты (>33) - ffl.msu.ru/ )

• About Us

... please find attached the second announcement about the VII Moscow International Conference on Operations Research (ORM2013) in October, 15-19, 2013 in Moscow, Russia. You are welcome to submit extended abstracts of your talks to 2013ORM@gmail.com. An extended abstract should be presented as a LaTex file in English language according to the attached template, and its volume should be three pages (or little less). Selected extended abstracts will be published in the Conference proceedings. ...

Еще в разделе: (Показать все результаты (>12) - io.cmc.msu.ru/ )

LABORATORY . ... COMPUTATIONAL . LEXICOGRAPHY . ... Research . ... Contact . ... Moscow State University . Scientific Research Computer Center . Laboratory for Computational Lexicography . ... SRCC MSU, GSP-1, Leninskie gory 1-4, . Leninskie gory 1-52, Second Humanities Building, r. 369, . Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>6) - lcl.srcc.msu.ru/ )

... ВШБ МГУ - школе . ... Международные связи . ... Высшая школа бизнеса МГУ им. М.В. Ломоносова является одним из соучредителей Ассоциации, наряду со школами бизнеса университетов Graduate School of International Management, Aoyama Gakuin University (Япония), School of Management, Fudan University (Китай), Tepper School of Business, Carnegie Mellon University (США), Rady School of Management, University of California, San Diego (США). ... Членство в международных образовательных ассоциациях и альянсах ...

Еще в разделе: (Показать все результаты (>18) - www.mgubs.ru/ )