... Correlative immunostaining with anti-tubulin antibodies and electron microscopy established that apparent free microtubules observed in vivo were not growing ends of long stable microtubules. ... A) Plus and minus ends of free MTs; (B) ends of long MTs. ... Minus ends of free MTs in PtK1 cells are stable The production of free minus ends of MTs in PtK1 cells has now been observed by three pathways: self-assembly in the cytoplasm, release from the centrosome (Keating et al., 1997) and breakage of MTs...

Еще в разделе: (Показать все результаты (>35) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/komarova2002.pdf
• http://cellmotility.genebee.msu.ru/html/articles/uzbekov96.pdf
• http://cellmotility.genebee.msu.ru/html/articles/alieva94.pdf

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>78) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/Laser-Phys-Lett-2004.pdf
• http://qilab.phys.msu.ru/papers/LasPhys10_03GrishaninLO.pdf
• http://qilab.phys.msu.ru/papers/SPIE-2547-312-319(1995).pdf

... You buy Gucci shades from the company store in the us. There are a total of 7 Gucci stores in different metropolitan areas like Honolulu, Hawaii, Boston. Or if you?re planning an overseas trip to Europe and then sure you visit part of the Gucci retail stores. One can find the brand stores in Florence, . ... These stores offer complete and original associated with designer Gucci Sunglasses and associated accents. ... One should be careful not purchaser gucci Fake. ... 2016 С Днем Победы! ...

Еще в разделе: (Показать все результаты (>175) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• Наши ветераны | С Днем Победы!
• cheap moncler developed by examiners through their skills and expertise | С

... The Laboratory of Bioorganic Chemistry and Molecular Imaging (LBCMI) at Swiss Institute of Technology, Lausanne (EPFL), Switzerland has an opening at the PhD level (http://lcbim.epfl.ch). ... The successful candidate should hold a master degree or equivalent in organic chemistry, chemical biology or other relevant discipline. ... The candidate should be open and interested in learning new techniques in biology and molecular imaging. ...

Еще в разделе: (Показать все результаты (>36) - www.chemport.ru/ )

• "Postdoctoral research position" - вакансия в разделе "Работа для химиков"
• "Phd position in homogenous catalysis" - вакансия в разделе "Работа для
• Foreign trade turnover of silicon carbide in russia for 2006-2007 present

The Department of Talented Youth Affairs and Professional Orientation . ... Moscow State University is actively using various mechanisms for working with talented students , including Universiades, Olympiads and tournaments, scientific conferences and forums, science reading sessions, seminars and debates, research paper competitions, summer and winter science schools (including out-of-campus events), and round tables. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>42) - talant.msu.ru/ )

• July 10, 2014 ?Innopraktika? holds first business networking for MSU research
• All-army olimpiad | The Department of Talented Youth Affairs and Professional
• Olimpiads | The Department of Talented Youth Affairs and Professional

DEADLINE: Tuesday, February 1, 2005 I. Program Overview The ECA Alumni Small Grants Program (ASGP) is a professional and community development program open to alumni of the following ECA-sponsored exchange programs: the Contemporary Issues Fellowship Program (CI), the FREEDOM Support Act Undergraduate Program (FSAU), the Regional Scholars Exchange Program (RSEP) and the Russian-US Young Leadership Fellows for Public Service Program (YLF.) ... 2005 ECA Alumni Small Grants Program [pic] ...

Еще в разделе: (Показать все результаты (>124) - www.prof.msu.ru/ )

• The conference "Human Rights in Russia: the past and the present"
• Trends in the Development of Political Science in Russia
• Conflict Transformation, Ngo And Networking

... In 1997, the work of Jens Skou devoted to discovery and the study of Na,K-ATPase was culminated in the Nobel Prize. ... Our group works in the collaboration with the University of Montrel, Canada (professor S.N. Orlov), and with the Engelgardt Institute of Molecular Biology, Moscow, Russia (Laboratory of conformational stability of proteins and physical methods of analysis, under the guidance of academician A.A. Makarov). ... S-glutathionylation of the Na,K-ATPase catalytic ? ... Biochemistry (Mosc)...

Еще в разделе: (Показать все результаты (>70) - biochem.bio.msu.ru/ )

• Sulfated and sulfonated polymers are able to solubilize efficiently the protein
• Silencing AML1-ETO gene expression leads to simultaneous activation of both
• [application of the analytical transmission electron microscopy techniques for

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>9) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf
• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt2_MATLAB_Workshop_SHORT.pdf

... Raman spectroscopy of solutions of charge-transfer complexes on the basis of semiconducting polymers. ... Dependences of shifts of the basic line of a Raman spectrum of MEH PPV on frequency of 1582 sm-1, position and intensity of a line of 966 sm-1 from concentration of TNF, and also dependence of position of a line on 1582 sm-1 from temperature were investigated. ...

Еще в разделе: (Показать все результаты (>217) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Smirnova_Shkurinov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Tsymbalov_Savel'ev_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Fedotov_Fedotov_en.pdf

... foot much roland suited representing an oliver.. ... Просмотров: 586 Тема: foot much roland suited representing an oliver up integument critique protruding в форуме: Кафедра гидрологии . ... i begged someone, haven't got fabulous, does destroy any person.This sort of Qin safe regarding finally journey Teacher Company coach outlet arizona Electric outlet About the internet together with overwhelming.At this stage desire Instruct Manufacturing plant Store ...

Еще в разделе: (Показать все результаты (>293) - www.geogr.msu.ru/ )

• CONTENTS ?1 - 2010
• CONTENTS ? 1 - 2013
• uzgnv

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>15) - sbmg.geol.msu.ru/ )

• Europrobe1

Langmuir 2003, 19, 1227-1234 1227 Dynamic Effects on Force Measurements. ... Theoretical calculations are used to formulate the governing equation (force balance) for instantaneous deflection of a cantilever spring, which is due to both concentrated forces acting on a colloidal probe and viscous drag force on a cantilever itself. ... M ) F(L cos R - x) (2) of AFM force measurements, and we incorporate the deflection due to hydrodynamic pressure on the cantilever to the AFM force balance. ...

Еще в разделе: (Показать все результаты (>36) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/pre2012_1.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2012_2.pdf
• http://nanofluidics.phys.msu.ru/paper/jcis3.pdf

... The external forces is [0,T ], the alge"practical" work forces) is in fact the sum (for all For a control force or torque u and a motion T braic work of external forces is W = udx = 0 u of external forces (i.e. the energy spent via the T |ux|dt. ... Our theory is twofold: 1. ... With the Maximum Principle, assuming the minimization of a criterion which is a compromise b etween the absolute work and some other term (comfort term), we prove that inactivations must appear. ...

Еще в разделе: (Показать все результаты (>39) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Agrachev.pdf

pic] Program of humanitarian aid from Russia Rectors' Union (RRU) to South-Ossetia's Tibilov State University The first batch of humanitarian aid from RRU to South-Ossetia's Tibilov State University was dispatched to Vladikavkaz by Ministry of Emergencies' charter plane at August 27. It included 1612 classical textbooks and manuals, and a modern computer training-room, comprised of 34 units of equipment. ... September 16, another charter plane has delivered the second batch of humanitarian aid. ...

Еще в разделе: (Показать все результаты (>38) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/111.doc
• http://www.rsr-online.ru/doc/2010_10_05/7.pdf
• http://www.rsr-online.ru/doc/2011_10_31/4.pdf

MSU . ... Every year since 2004, the MSU Science Park has conducted an educational program and an innovation project competition called Success Formula (www.successformula.ru). ... In collaboration with the Center of Technology Transfer at Moscow State University and the Chair of Innovation Economics, MSU Science park offers a wide range of educational programs like Success Formula as well as infrastructure projects geared to the incubation of new technology companies on the Moscow University site. ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )

• MSU Science Park - Companies
• MSU Science Park - Venue & Space

... 35, No. 2, pp. 87­99. i Star Formation History in the Central Region of the Barred Galaxy NGC 4245 O. K. Sil'chenko1* , I. V. Chilingarian1, 2 , and V. L. Afanasiev 1 2 3 Sternberg Astronomical Institute, Universitetskii pr. ... The galaxy has been found to possess a pronounced chemically decoupled compact stellar nucleus, which is at least a factor of 2.5 richer in metals than the stellar population of the bulge, and a ring of young stars with a radius of 300 pc. ... NGC 4245. ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/990399.ps.gz
• http://sn.sai.msu.ru/~sil/preprints/al534.pdf
• http://sn.sai.msu.ru/~sil/preprints/n4548.pdf.gz

Femtosecond Time-Resolved Transverse Kerr Effect Measurements in Magnetoplasmonic Crystals A. Yu. ... Application of external magnetic field to a magnetic medium causes alteration of reflected light amplitude that is so-called magneto-optical Kerr effect. ... For example, excitation of surface plasmon polaritons (SPP) in a magnetized sample by femtosecond laser pulses can lead to time moduation of magneto-optical transversal Kerr effect (TKE) intensity that differs from its steady-state value. ...

Еще в разделе: (Показать все результаты (>94) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/pre80_046602_2009.pdf
• http://nanolab.phys.msu.ru/sites/default/files/iconolat_pasha11.pdf
• http://nanolab.phys.msu.ru/sites/default/files/ol-39-24-6895_0.pdf

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... New approaches to the synthesis of hybrid materials InP - organic stabilizer . ... To replace the membranes using standard samples CT InP, myristic acid, stabilized, and samples heterostructures InP / ZnSe with two monolayers Accrued zinc selenide and also stabilized myristic acid. ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>12) - www.lssm.inorg.chem.msu.ru/ )

Prof. A.Nekipelov Moscow School of Economics , Moscow State University Lomonosov The Concepts of Economic Growth and Economic Development: Standard Macroeconomics and Pure Economics Approaches A Lecture Presented on January 31, 2011 at the International School f or Students Organized by IASSA and Department of Computational Mathematics and Cybernetics, MSU Lomonosov Economic Growth and Its Measurement by ... This distinction is applicable to the field of economic investigation. ...

Еще в разделе: (Показать все результаты (>21) - www.mse-msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf