... 2012. Vaughan, W. Digital Modelling, 2012. ... Heritage, G.L., Large, A.G. Laser scanning for the Environmental Sciences. 2009. ... Ikeuchi, K., Miyakzaki, D. Digitally Archiving Cultural Objects. 2008. ... Digital Human Modelling: Third International Conference, ICDHM 2011, Held at FL, USA, July 9-14 2011.Springer. ... 2010. ...

Еще в разделе: (Показать все результаты (>45) - www.anthropos.msu.ru/ )

... В работе рассматривается двухмерная математическая модель лесных пожаров, приводится алгоритм численного решения и результаты тестовых расчетов. ... В работе [1] была предложена двухмерная модель лесных пожаров, построенная методом осреднения исходных трехмерных уравнений газовой динамики по высоте слоя лесных горючих материалов, который рассматривается как одноярусная двухфазная (газовая и твердая фазы) двухтемпературная реакционноспособная среда. ... Газовая фаза: . ... коэффициент диффузии, . ...

Еще в разделе: (Показать все результаты (>45) - www.library.biophys.msu.ru/ )

• МОДЕЛЬ ДИНАМИКИ БИОМАССЫ ЖИВОГО НАПОЧВЕННОГО ПОКРОВА В ЛЕСУ
• ЖИЗНЕСПОСОБНОСТЬ ПОПУЛЯЦИЙ ПРИ ИМПУЛЬСНОМ ВОЗДЕЙСТВИИ ТОКСИКАНТОВ
• SimpMeth

... The latter should be taken into account and carefully modeled as a fluid-structure interaction (FSI) problem. A patient- specific FSI analysis is impossible because it predicts only estimated hemodynamic features which are based on assumptions regarding material properties. The objective of this study is to develop a new methodology that assimilates medical imaging data for quantitative hemodynamic data extraction. ...

Еще в разделе: (Показать все результаты (>56) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/abstracts/Kurbatsky.doc
• http://hit-conf.imec.msu.ru/2012/lectures/index.html

Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, Department of the English Language Abstract Categorical Models of Quantum Mechanics By Alexander Zapryagaev, group 304 21 October 2014 The report deals with the axiomatic approach to the phenomena of quantum computation and algorithms. ... Finally, the logic behind quantum operations is discussed: it is revealed that the ideas of quantum algorithms have a strong connection to Jean-Yves Girard's linear logic. ...

Еще в разделе: (Показать все результаты (>9) - www.eng.math.msu.su/ )

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>216) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• Index of /npidb/pdb

обзор! astro-ph/0207223 . ... Author: Sultana N. Nahar . Comments: 15 pgs., 5 color figs., ... Comments: 46 pages including 16 figures, uses eas.cls, to appear in the proceedings of the Aussois 2001 summer school "Stades Ultimes de l'Evolution Stellaire", EAS Pub. ... Comments: 26 pages, 5 figures, submitted to ApJ . ... Commets: 5 pages, 4 figures, to appear in: Pis'ma v Astronomicheskii Zhurnal, 2003, v.29, No.2, p111-115 and will be translated as: Astronomy Letters, v.29, No.2, p.91-95 . ...

Еще в разделе: (Показать все результаты (>272) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/2002-07_2003_03/sun.html
• Новости науки

Heat transfer intensification on surfaces with 'eddy generating' relief at supersonic velocity of incident flow . ... Temperature field on plates with 'eddy generating' relief (dimples and projections) М=3.1 . Local coefficients of heat transfer distribution on plates with 'eddy generating' relief (dimples and projections) and a smooth plate flown over by supersonic air stream M=3 . ... Temperature distribution during flowing of supersonic stream over a single dimple . ...

Еще в разделе: (Показать все результаты (>10) - termogaz.imec.msu.ru/ )

• MAU_main_e
• AR-2 main_e
• stratif_E

... Г. А. Голицын, А. П. Левич, 2004 . ... страница HTML, 283 Кб . размещено 11.07.2010 . ... PDF-файл, 384 Кб . ... страница HTML, 42 Кб . ... страница HTML, 475 Кб . ... страница HTML, 168 Кб . ... 4 C.569-578. страница HTML, 90 Кб . ... С.13-23. страница HTML, 121 Кб . ... страница HTML, 139 Кб . ... М.: Товарищество научных изданий КМК. 1996. 136 с. страница HTML, 1170 Кб . ... страница HTML, 147 Кб . ... страница HTML, 134 Кб . ... А. П. Левич, П. В. Фурсова, 2002 . ... страница HTML, 542 Кб . ...

Еще в разделе: (Показать все результаты (>61) - dis.bio.msu.ru/ )

... Bachelor Program . Master Program . ... The Department of Operations Research . ... researchers specialized in mathematical models and methods of economic regulations . ... possess a profound knowledge in the field of e со nometrics, risk theory, actuarial and financial mathematics, the theory of games, operations research, economic regulation on micro and macro levels . ... can use modern computer technologies in order to construct models and solve optimization problems . ... exam . ... test . ...

Еще в разделе: (Показать все результаты (>28) - io.cmc.msu.ru/ )

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>190) - biochem.bio.msu.ru/ )

• [Search for chaperon-like anticataract drugs, the antiaggregants of lens
• Human pro-B-type natriuretic peptide is processed in the circulation in a rat
• Expression of NMDA receptors in multipotent stromal cells of human adipose

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Mathematical modeling of the accuracy characteristics in problems of precision quantum tomography of biphoton states?, ... A model that approximately takes into account instrumental errors in problems of precision reconstruction of quantum states is considered. ... Various sources of instrumental errors that affect the reconstruction accuracy of quantum states are mathematically modeled. ...

Еще в разделе: (Показать все результаты (>52) - qi.phys.msu.ru/ )

... Спецкурсы | ... История . ... Введение в языкознание . Общее языкознание . История языкознания . ... Русский язык как иностранный . ... Компьютерная лингвистика и машинный перевод . ... What does the term "Applied Linguistics" stand for. ... Terminological science as a very important domain of the applied linguistics. ... Informatization of modern society and applied linguistics. ... Prospects of the development of applied linguistics and its interactions with theoretical linguistics. ...

Еще в разделе: (Показать все результаты (>826) - genhis.philol.msu.ru/ )

RUSSIAN version . ... Tatyana Aleksandrovna ILYINA . ... Dolnik V.R., N.V. Vinogradova, V.M. Gavrilov, T.V. Dolnik, T.A. Ilyina , D.S. Lyuleeva, V.A. Payevsky, L.V. Sokolov, M.E. Shumakov, M.L. Yablonkevich. ... L., 'Nauka'. 302 с. In Russian, English summary. ... In Russian, English summary. [download pdf-file] . ... Kerimov A.B., Ivankina E.V., Ilyina T.A. , Gavrilov V.M. 1994. ... Ilyina T.A., Ivankina E.V. 2001. ... H.Sternberg, V.G. Grinkov, E.V.Ivankina, T. A.Ilyina, A.B.Kerimov, A.Schwarz. ...

Еще в разделе: (Показать все результаты (>737) - vertebrata.bio.msu.ru/ )

• А.В.Кленова
• Anna V.Klenova
• Т.А. Ильина

... The Department of Operations Research . ... Coordinators Contacts . ... on Operations Research, . ... Moscow, April 10-14, 2007 Coordinators . ... 1) New models and methods . Prof. V.V. Morozov . ... 3) Multiple objective decision making . ... Prof. I.G. Pospelov, Prof. A.A. Shananin . ... Prof. A.A. Belolipetckiy . ... 9) Game-theoretic models . ... Symposium A: Analysis of the markets and decision making in electric power industry . ... Symposium B: Models of political decision making. ...

Еще в разделе: (Показать все результаты (>6) - io.cs.msu.ru/ )

• Traditional topics of the conference - ORM 2007

... Single station indices on the level of cosmic ray activity . Real time cosmic ray variation on Moscow Neutron Monitor . Apatity and Barentsburg cosmic ray stations . Arctic Center Cosmophysical Prognosis (Russian version) . Arctic Center Cosmophysical Prognosis (English version) . Data Base of Yakutsk, Tixie Bay and others neutron monitors (since Jan 1, 1980 ) . Aragats Neutron Monitor . ... Model of Galactic Cosmic Rays (SINP MSU GCR model) . ...

Еще в разделе: (Показать все результаты (>8) - dbserv.sinp.msu.ru/ )

• Links

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>206) - higeom.math.msu.su/ )

• Alexey Garber (Russian)
• Mishchenko Alexandr S.

... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>11) - engineering.phys.msu.ru/ )

• Introduction to Linux

Theory as a Lighthouse in the Electrochemical Ocean . In memory of Alexander M. Kuznetsov . ... Until his last days he continued to work on various aspects of charge transfer phenomena. ... In electrochemical kinetics the theory always outruns the experiment, and the quantum mechanical theory of charge transfer created in the famous Theoretical Department of the Frumkin Institute in Moscow (R.R. Dogonadze, A.M. Kuznetsov and co-authors) is a good example for that. ...

Еще в разделе: (Показать все результаты (>85) - electr003.chem.msu.ru/ )

• Laboratory of Electrochemical energetics
• Liana N. Sviridova: Selected Publications
• Elena V. Stenina: Selected Publications

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>5) - composite.msu.ru/ )

... CUDA Center of Excellence | MSU . ... Lomonosov Moscow State University (MSU) was awarded an NVIDIA CUDA Center of Excellence (CCOE) in 2011 for being one of the first Russian universities to recognize the importance of emerging GPU technologies and first to embrace CUDA. ... Lomonosov Moscow State University (MSU) is renowned as one of the leading computer science centers excelling in application of computational resources to address most vital scientific problems. ...

Еще в разделе: (Показать все результаты (>5) - ccoe.msu.ru/ )