... 1, 2000 . ... Compilation of Red List algae of Ukraine. ... Express diagnostics of tropho-saprobic condition of coastal ecosystems using surface indiced of benthic alga. ... Variability of the pigment apparatus in Cyanophyta depending on carbon nutrition conditions. ... A.G. Nedosekin, V.N. Maksimov . Complex assesment of a model population of Chlorella pyrenoidosa Chick. ... T.N. Ovsyannikova, N.G. Mironova, V.N. Zabolotny, A.G. Gubanova, L.Ya. ...

Еще в разделе: (Показать все результаты (>330) - herba.msu.ru/ )

• Komarovia

... Геоморфологии и палеогеографии . Географии мирового хозяйства . ... Гидрологии суши . ... Выберите кафедру . ... Ученый совет . ... Образование . ... Научно-методический совет по экологии Министерства образования и науки РФ . ... model_K37 . ... Кафедра геоморфологии . ... Все сообщения пользователя . ... Текст cooбщения . ... Кафедра геоморфологии Кафедра гидрологии . ... Информация о предстоящих защитах диссертаций на соискание ученой степени кандидата, доктора географических наук Подробнее . ...

Еще в разделе: (Показать все результаты (>37922) - www.geogr.msu.ru/ )

• Title
• CONTENT 1 (3) 2010
• CONTENT 1а(3)а2010

... allpy/structure.py . ... 1.1 --- a/ allpy / structure .py Thu Jul 14 18:15:45 2011 +0400 1.2 +++ b/ allpy / structure .py Fri Jul 15 02:56:28 2011 +0400 1.3 @@ -234,21 +234,21 @@ 1.4 1.5 def save_pdb(self, out_filename, new_chain =None, new_ model =None): 1.6 Save pdb_ chain to out_file 1.7 - class MySelect (Select): 1.8 - def accept_ chain ( myselect , chain ): 1.9 - if chain == self.pdb_ ...

Еще в разделе: (Показать все результаты (>4969) - kodomo.fbb.msu.ru/ )

• Alex Makarov. Personal Page. Modelling and reconstruction of trees II.
• Alex Makarov. Personal Page. Modelling and reconstruction of trees I.
• allpy: 2c0391cca127

.

Еще в разделе: (Показать все результаты (>316) - www.chemport.ru/ )

• "Postdoctoral research position" - вакансия в разделе "Работа для химиков"
• Химия во всех проявлениях - Химический портал ChemPort.Ru
• "PhD in France" - вакансия в разделе "Работа для химиков" @ChemPort.Ru

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>341) - lnfm1.sai.msu.ru/ )

• The mass and the moment of inertia of the Earth
• MSSA results
• Труды Ширмина Г.И.

... The factors that play the key role in complex formation are as follows: the rate of protein diffusion to the docking site; long-range electrostatic interactions between protein surfaces, geometric and chemical complementarity of binding areas; molecular mobility at the protein­protein interphase, hydrogen bonds, Van der Waals interactions, hydrophobic interactions, and salt bridges. ... Three-dimensional protein molecules are constructed on the basis of data extracted from the Protein Data Bank. ...

Еще в разделе: (Показать все результаты (>52) - www.library.biophys.msu.ru/ )

• http://www.library.biophys.msu.ru/PDF/80521.pdf
• МАТЕМАТИЧЕСКОЕ МОДЕЛИРОВАНИЕ ЛЕСНЫХ ПОЖАРОВ

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>82) - biochem.bio.msu.ru/ )

• Heterooligomeric complexes formed by human small heat shock proteins HspB1

... Common information . ... 1.888 . ... since 1975-05-01 till today . ... subscription - $1017,single article - $30 . ... Elsevier Science . ... http://www.elsevier.com/wps/find/jour.. ... today . toc, abstract . http://www.sciencedirect.com/science/... 1995-01-01 . ... http://elibrary.ru/issues.asp?id=302 . ...

Еще в разделе: (Показать все результаты (>1569) - journals.genebee.msu.ru/ )

• JCatalog journal list
• JCatalog - Список журналов

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>226) - higeom.math.msu.su/ )

• INVITED ADDRESSES:
• Mishchenko Alexandr S.
• Toric Topology (English)

... education . ... Functional Nanomaterials . ... Composite Nanomaterials Master?s Program . ... admission in January 2010 . ... MSU Faculty of Chemistry announces a new Master?s Program in Composite Nanomaterials, 510500 Chemistry. The program is under the aegis of MSU Nanotechnology Education and Research Center. ... The program is aimed mainly at graduates and young scientists, including Candidates of Science, in chemistry or physics (additional higher education.) ...

Еще в разделе: (Показать все результаты (>73) - nano.msu.ru/ )

• Scientific seminars | MSU Nanotechnology Education and Research Center
• International Collaboration | MSU Nanotechnology Education and Research Center
• The 7th International Nanoscience Student Conference, London, 19?22 August 2013

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6966) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb

Research topics . ... This group is formed to study the reactions at semiconductor surfaces. ... Group members: . ... M.V. Lomonosov Moscow State University: . ... Dr. Tatiana S. Zyubina, senior scientific researcher (quantum chemical modeling) . ... Joint Semiconductors Surface Study group: research sketches . The Joint Semiconductors Surface Study (JSSS) group was developed on the base of Inorganic Chemistry division, Chemistry dept. of M.V. Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>108) - www.inorg.chem.msu.ru/ )

... Lomonosov Moscow State University . ... Home About The Department of land resources . ... The main tasks of the Department is the development of methods for effective land management aimed at sustainable development and food security, implementing technology for soil protective land using, analysis of the current state of land resources, assessment of land degradation and water quality reduction. ... The Department of land resources is headed by doctor of biological Sciences Pavel Krasilnikov. ...

Еще в разделе: (Показать все результаты (>40) - ecfs.msu.ru/ )

• Economic Department | ECFS
• Communication and Information Department | ECFS
• About Eurasian Center for Food Security | ECFS

The Department of Talented Youth Affairs and Professional Orientation . ... Posted on 24.06.2014 by admin . The first business networking ?to attract investment in the field of electronics? will be held July 10 at the Moscow State University with the participation of the body of scientific groups MSU, representing the Department of Physics, Department of Materials Science and Mechanics and Mathematics Faculty, companies belonging to the Group of Companies ?Rostech? and ?Innopraktika?. ...

Еще в разделе: (Показать все результаты (>94) - talant.msu.ru/ )

• National intellectual development Fund paid trips to summer school | The
• admin | The Department of Talented Youth Affairs and Professional Orientation |
• International Youth Scientific Forum ?Lomonosov? | The Department of Talented

. Название публикации . T-cadherin suppresses the cell proliferation of mouse melanoma B16F10 and tumor angiogenesis in the model of chorioallantoic membrane . Авторы . E.I. Yurlova, K.A. Rubina, V.Yu. Sysoeva, G.V. Sharonov, E.V. Semina, Ye.V. Parfenova, V.A. Tkachuk . Дата . 31.12.2009 23:00:00 . Название журнала . Cell Differentiation and Proliferation. Том . Vol.41 . Номер . 4. первая страница . 217 . последняя страница . 226. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>24) - fbm.msu.ru/ )

... Research . ... 1976 – current: Moscow State University . ... Moscow State Institute of Foreign Languages (currently - Moscow Linguistic University), Translation Faculty, Department of Machine Translation . ... Degree granted through Moscow State University, Department of Structural and Applied Linguistics, V.A.Zvegintsev, Head . ... Russian State Humanitary University, Department of General and Applied Linguistics. ... Moscow State Linguistic University, Department of General Linguistics. ...

Еще в разделе: (Показать все результаты (>69) - lcl.srcc.msu.ru/ )

AFM studies of DNA condensation . ... Toroidal DNA-surfactant complexes on mica substrate . ... DNA molecules condensed in water-isopropanol media and deposited onto mica substrate . ... We carried out the set of AFM-studies of different DNA-condensation mechanisms in media with different polarity (aqueous solution, water-alcohol mixture, chloroform and so on). ... V.G. Sergeyev, O.A. Pyshkina, M.O. Gallyamov , I.V. Yaminsky , A.B. Zezin, V.A.Kabanov, DNA-surfactant complexes in organic media. ...

Еще в разделе: (Показать все результаты (>97) - www.spm.genebee.msu.ru/ )

• Igor Yaminsky's homepage
• Denis Igorevich Trofimov

... The INTERNATIONAL MAX PLANCK RESEARCH SCHOOL (IMPRS) for . ASTRONOMY and COSMIC PHYSICS at the UNIVERSITY of HEIDELBERG . ... HEIDELBERG SUMMER SCHOOL on the . INTERSTELLAR MEDIUM . ... interdisciplinary research of the interstellar medium. ... THOMAS HENNING, Max Planck Institute for Astronomy, Heidelberg . ... International Max Planck Research School (IMPRS) for . Astronomy and Cosmic Physics at the University of Heidelberg . Max Planck Institute for Astronomy . ...

Еще в разделе: (Показать все результаты (>129) - sai.msu.ru/ )

• GCVS Research Group: History and Persons.
• International School "Frontiers in Numerical Gravitational Astrophysics"

Sergey Petrushanko, "Azimuthal flow and correlations in heavy-ion collisions with CMS at the LHC and HYDJET++ model" . ... International Conference-Session of the Section of Nuclear Physics of the Physical Sciences Division of RAS "Physics of Fundamental Interactions" . ... Moscow, Russia, 17-21 November 2014) http://www.icssnp.mephi.ru/en http://www.icssnp.mephi.ru/ru . Sergey Petrushanko, "Recent CMS resutls from PbPb and pPb collisions" . 16th Annual RDMS CMS Collaboration Conference . ...

Еще в разделе: (Показать все результаты (>148) - lav01.sinp.msu.ru/ )

• Etapi- Comments 3/1/97
• Seminar of Strong Interaction Laboratory

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>10) - www.bio.msu.ru/ )