. Адрес: 119992, ГСП-2, Москва, Ленинские горы, МГУ, Главное здание, А-1008 . тел.: (095) 939 37 67 факс: (095) 939 02 59 . Все права на материалы, опубликованные на сайте Управления, принадлежат МГУ им.М.В. Ломоносова. При использовании материалов сайта ссылка на наши выходные данные обязательна. Просим сообщать нам о замеченных неточностях и опечатках. Webmaster . 2002-2005 УОСиП МГУ All rights reserved .

Еще в разделе: (Показать все результаты (>11) - www.edst.msu.ru/ )

• Информация

... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...

Еще в разделе: (Показать все результаты (>44) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/brun/Solutions_2.doc
• Untitled

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... UFFO . ... October 9, 2011 . The ?Lomonosov? project was presented at the Russian Science Festeval. ... The connecting operation between the scientific equipment of the Lomonosov project and scientific telemetric system was started at joint stock company ?Russian Space Systems?. ... The flying model of UFFO device has arrived. ... The ?Lomonosov? project was presented at the international aerospace show MAKS 2011. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• Publications | Университетский спутник "Ломоносов"
• Automatic gaze stabilization corrector | Университетский спутник "Ломоносов"

International Maize and Wheat Improvement Center No. ... AFRICA "Maize production is likely to suffer the most due to climate change compared to other crops in Southern Africa," said CIMMYT physiologist Jill Cairns, who presented on CIMMYT work under the CGIAR Research Program on Climate Change, Agriculture and Food Security (CCAFS) at the FAO Agriculture Coordination & Information Forum in Harare, Zimbabwe, on 25 July 2013. ... Policy makers in the seed value chain must be engaged as well. ... 2013. ...

Еще в разделе: (Показать все результаты (>62) - ecfs.msu.ru/ )

Описание вакансии: . Vacancy: R Scientist, PhD (m/f) . ... Demonstrate and maintain expert knowledge in this scientific field. Act as a subject matter expert and technical resource for the organization, in close cooperation with teams all over the world (mainly in USA). ... PhD in catalysis-related chemistry field (Organic Chemistry, Organometallic Chemistry, Inorganic Chemistry, or Chemical Engineering). ... список всех вакансий . добавить вакансию . редактировать эту вакансию . ...

Еще в разделе: (Показать все результаты (>18) - www.chemport.ru/ )

• "R scientist/expert in catalysis-related chemistry, phd (m/f)" - вакансия в
• Real estate market monitoring august 2010 инвистиционно-ипотечные проекты
• Branch review "rating retailers fmcg of russia august 2010" классификация

... Bashindzhagyan G . ... Panasyuk M . ... Proc.26th ICRC, Salt Lake City , 1999, v.5, p.132-135. Bashindzhagyan G.L., Samsonov G.A., Khein L.A., Panasyuk M.I., . Voronin A.G., Zatsepin V.I., ATIC Collab .. The Advanced Thin Ionization Calorimeter (ATIC) for Studies of High . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.9-12. ... Silicon Matrix Detector for ATIC . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.453-456. ... Advanced Thin Ionization Calorimeter (ATIC) .- ...

Еще в разделе: (Показать все результаты (>26) - silab.sinp.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>154) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• BioSystems, 30 (1993) 57-63 57

. To see a Russian version of this page click here . (Senior Researcher. Graduated from Moscow State University (MSU) in 1982, Ph.D. 1986, MSU) . A member of EAS and IAU. Fields of interest: hot massive stars, close binary systems: optical photometric and spectral observations, X-ray observations; ill-posed problems, X-ray astrophysics. My publications (ADS link) . Linux on CLEVO 8750 (old stuff) . Phones/addresses of my university mates graduated in 1982. E-mail: igor@sai.msu.ru .

Еще в разделе: (Показать все результаты (>21) - uranus.sai.msu.ru/ )

• Tatjana Khruzina
• Victor Oknyanskij
• Elena Seifina. Publications

... 13, Moscow 119991, Russia §UK Astronomy Data Centre, Guest Investigator (Received 20 June 2007) The kinematics, structure, and stellar population properties in the centres of two brightest early-type galaxies of the Leo II group, NGC 3607 and NGC 3608, are studied by means of integral-field spectroscopy. ... Figure 1. ... Chemically decoupled cores in NGC 3607 and NGC 3608 3.1 NGC 3607 Figure 3 presents index maps for the central part of NGC 3607 constructed from the MPFS 2D spectral data. ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/ilyina_sil.pdf
• http://sn.sai.msu.ru/~sil/preprints/counter.pdf
• http://sn.sai.msu.ru/~sil/preprints/leo3.pdf

... Chemical Department . ... 7 (495) 939-31-70, Fax: +7 (495) 939-31-70, +7 (495) 939-54-17 . ... 1999 - 2004 . Master's Degree, The M.V. Lomonosov Moscow State University, Chemical Faculty, Chemical Enzymology Department (2004) . ... Strong background in Chemistry (Biochemistry, Organic chemistry, Analytical chemistry, Inorganic chemistry, Physical chemistry, Chemistry of polymers, Radio-chemistry), biochemistry, molecular biology, Physics (course of Theoretical physics, the Theoretical mechanics) . ...

Еще в разделе: (Показать все результаты (>139) - www.enzyme.chem.msu.ru/ )

• Group of microbial biochemistry and biotechnology
• The Kinetic Mechanism of Formate Dehydrogenase from Bakery Yeast

Ministere de l'educat ion nat ionale, de l'enseignement superieur et de la , recherche . ... It is also strange, to say the least, that such has been levied only now, years after the publishing o f the another proof of dishonest y and disinformat ion of their author. another proof count. This is an accusatio n book. ... 2006) - . ... It is the very contrary and to say the least quite an achievement in the Russia n academic landscape where inst itutions have been for so long a "black spot". ...

Еще в разделе: (Показать все результаты (>26) - www.mse-msu.ru/ )

... THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY METALS . Galina Koptsik . ... Development of current principles and approaches for soil remediation in heavy metal polluted areas. ... The project aims to study and develop, both theoretically and experimentally, the current approaches to remediation of soils polluted with heavy metals. ... Potentialities and constraints of different approaches for remediation of heavy metal polluted soils will be analysed. ...

Еще в разделе: (Показать все результаты (>17) - eco.soil.msu.ru/ )

• Norwegian-Russian cooperation in the border area

The monitoring of the optics quality of DIMM instrument V. Kornilov, B. Safonov May 24, 2010 1 Intro duction A quantitative theory of measurement of optical turbulence (OT) with Differential Image Motion Monitor (DIMM) is based on certain priori assumptions [1]. ... Bottom: behavior of the instrumental Strehl's number for the left (triangle to the left) and right (triangle to the right) DIMM images during the period of measurement the maintenance of an additional correction factor seems superfluous. ...

Еще в разделе: (Показать все результаты (>20) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/new_mass_cat.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_specs.pdf

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>107) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-1.pdf

... Phys. Lett., ... Phys. Rev. E, 2015, V.91, 033020 ( PDF ) . ... E.S.Asmolov, A.V.Belyaev and O.I.Vinogradova, Drag force on a sphere moving towards an anisotropic super-hydrophobic plane, Phys. Rev. E, 2011, V.84, 026330 ( PDF ) . ... F.Feuillebois, M.Z.Bazant and O.I.Vinogradova, Effective Slip over Superhydrophobic Surfaces in Thin Channels, Phys. Rev. Lett., ... O.I.Vinogradova and G.E.Yakubov, Surface Roughness and Hydrodynamic Boundary Conditions , Phys. Rev. E, 2006, V.73, 045302(R) ( PDF ) . ...

Еще в разделе: (Показать все результаты (>59) - nanofluidics.phys.msu.ru/ )

• Laboratory of Micro- and Nanofluidics
• Teaching
• Olga I. Vinogradova

... 247th American Chemical Society National Meeting and Exposition "Chemistry and materials for energy" , March 16-20, Dallas, TX Talk: A.V. Nemukhin "QM/MM-based modeling of structure and spectra of fluorescent proteins" . ... IV International Symposium "Topical Problems of Biophotonics", July 21-27, Nizhny Novgorod Invited talk: M.G. Khrenova , A.V. Nemukhin, A.P. Savitsky "Molecular modeling of the Forster resonance energy transfer between fluorescent proteins" . ...

Еще в разделе: (Показать все результаты (>10) - lcc.chem.msu.ru/ )

• Publications

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>11) - ocean.phys.msu.ru/ )

... 2 dne 2 = i ne + ( D ne ) - r ne . ... bi , ( ) bi : (7) bi вp = Const [ 2 / ] . ... Ti = Tg. : dTe = - eg (Te - Tg ) , dt k bi (Te + Ti ) , e (6) (8) 3 eg - , - , . eg , (8) : t Te (t ) - Tg = (Te (0) - Tg ) exp (- ) , (9) Te(0) - ( ), = 1 - eg , = 2me / M , = M 2me eg , me - . ... 10 i = 4,1в106вpвexp( - eIi / kTe )в( kTe /e ) 0,5 вIi , ( 1 / ) ( 23 ) p - , Ii - , Ii = 24,5 , kTe / e - . ... LEFT», «RIGHT») , . ENTER» , , , .. ESC» ­ 1 . ... ln (Net/Ne0)» « (1/N)» « » «» - . ...

Еще в разделе: (Показать все результаты (>4) - physelec.phys.msu.ru/ )

... 31-Oct-2005 23:37 . ... 1.0K . ... 27-Aug-2007 10:23 . ...

Еще в разделе: (Показать все результаты (>8) - textbook.sinp.msu.ru/ )

• Index of /modules/ax_content/atomax/spaw/lib/themes/default/img
• Index of /modules/ax_visitors/atomax
• Index of /modules/ax_content/atomax

... Statutes of ERC . Methodical Commissions of ERC . ... The Methodical Commissions of the MSU Nanotechnology Education and Research Center (ERC) are set up according to all the research specializations of ERC. The Methodical Commissions of ERC are collegial bodies that prepare education programs of ERC and programs for developing courseware and training materials. ... ERC participants may be mutually agreed with members of methodical commissions representing relevant faculties and chairs. ...

Еще в разделе: (Показать все результаты (>9) - nano.msu.ru/ )

• The 7th International Nanoscience Student Conference, London, 19?22 August 2013