. To see a Russian version of this page click here . (Senior Researcher. Graduated from Moscow State University (MSU) in 1982, Ph.D. 1986, MSU) . A member of EAS and IAU. Fields of interest: hot massive stars, close binary systems: optical photometric and spectral observations, X-ray observations; ill-posed problems, X-ray astrophysics. My publications (ADS link) . Linux on CLEVO 8750 (old stuff) . Phones/addresses of my university mates graduated in 1982. E-mail: igor@sai.msu.ru .

Еще в разделе: (Показать все результаты (>20) - uranus.sai.msu.ru/ )

• Tatjana Khruzina
• Elena Seifina. Publications
• Katsova Livshits poster paper on CS-11

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Web Sites . ... Faculties . ... Series 1. Mathematics. ... Journal "Fundamental and Applied Mathematics" . ... Department of Invertebrate Zoology, Moscow State University. ... The journal is published annually by Russian Psychological Society and Faculty of Psychology of MSU . ... Lomonosov Moscow State University . ... Copyright 1997?2016 Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>71) - www.msu.ru/ )

• Scientific and scholarly publications in 2009
• Textbooks and handbooks publications in 2008
• New Publications (2003)

Home People Activities Research Publications . Yurin's home page . ... Юрин Д.В. "Расчетно-параметрическое исследование флуктуаций сигнала обратного рассеяния при лазерном зондировании взволнованного моря " // Автореферат диссертации на соискание ученой степени кандидата физико-математических наук (специальность 01.04.03-радиофизика). ... Юрин Д.В. "Метод расчета статистических характеристик сигнала обратного рассеяния при лазерном зондировании взволнованного моря " // В кн. ...

Еще в разделе: (Показать все результаты (>18) - imaging.cs.msu.ru/ )

Europrobe Moscow Workshop, October 29, 2001, Vernadsky museum . DSCN2329.JPG . DSCN2331.JPG . DSCN2332.JPG . ...

Еще в разделе: (Показать все результаты (>13) - sbmg.geol.msu.ru/ )

• INTAS team Workshop, October 28, 2001, Moscow university
• Calendar Converter
• Photoalbums

Solid State Physics Chair and Magnetism Department of M.V.Lomonosov Moscow State University . Joint RFBR-Helmholtz grant "Defects in magnetic TiO2" ("DETI.2") (HRJRG-314 & RFBR #12-02-91321-SIG_a"; 01.02.2012 - 01.02.2015): . DETI.2 (English) . ... Midterm Workshop at Moscow State University: . October 9th - 14th 2013, Moscow, Russia . ... Kay Potzger (HZDR): "Diluted magnetic semiconductors and oxides - resurrection"; . ... 19h30 - 22h30: joint Workshop Dinner on the Moscow-river; . ...

Еще в разделе: (Показать все результаты (>13) - magn.phys.msu.ru/ )

• Information for 2nd year students

... Chemical Enzymology Department, Chemical Faculty . The M.V. Lomonosov Moscow State University, Lenin's Hills, 1/11 Moscow 119991, Russia . ... 7 (495) 939-31-70, Fax: +7 (495) 939-31-70, +7 (495) 939-54-17 . ... Ph.D. student, Moscow State University of Food Production, Biotechnology Faculty, Moscow, Russia, 2003 - 2006 . Master's Degree, Moscow State University of Food Production, Biotechnology Faculty, Moscow, Russia, 2003 . ... Number of Patents and Patent Proposals: 3 . ...

Еще в разделе: (Показать все результаты (>130) - www.enzyme.chem.msu.ru/ )

• Ryabov
• Stepanov N.A.
• Senko O.V.

... - behave-, believe-, blurred-, body- border- both-; ... , ... bottom-, bursary- but-, , ; ; , calculate-, capable-, , carry-, ~ away - ~out- Cartesian- case-, cause-; cathode- centre- 4 certainly-, champion- (- ), , , change-, , characterise-() characteristic-, ... weight- whereas- while-, whole-, wide-, , width- witness-, wonder- no ~ - worth- to be ~ doing smth- - Y yield- Z zinc- 35 ...

Еще в разделе: (Показать все результаты (>24) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Model_rendering.pdf
• http://www.eng.math.msu.su/download/Academic_English_part1.pdf

... Redox-dependent change of nucleotide affinity to the active site of the mammalian complex I. Authors: . ... A very potent and specific inhibitor of mitochondrial NADH:ubiquinone oxidoreductase (complex I), a derivative of NADH (NADH-OH) has recently been discovered (Kotlyar, A. B., Karliner, J. S., and Cecchini, G. (2005) FEBS Lett. ... Both the rate of the NADH-OH binding and its affinity to complex I are strongly decreased in the presence of succinate. ...

Еще в разделе: (Показать все результаты (>211) - biochem.bio.msu.ru/ )

• Measurement of B-type natriuretic peptide by two assays utilizing antibodies
• Allosteric nucleotide-binding site in the mitochondrial NADH:ubiquinone
• Novel immunoassay for quantification of brain natriuretic peptide and its

... please find attached the second announcement about the VII Moscow International Conference on Operations Research (ORM2013) in October, 15-19, 2013 in Moscow, Russia. You are welcome to submit extended abstracts of your talks to 2013ORM@gmail.com. An extended abstract should be presented as a LaTex file in English language according to the attached template, and its volume should be three pages (or little less). Selected extended abstracts will be published in the Conference proceedings. ...

Еще в разделе: (Показать все результаты (>20) - io.cmc.msu.ru/ )

• The Department of Operations Research

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50љnm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>150) - nanolab.phys.msu.ru/ )

• Alexandr I. Musorin | Laboratory of Nanophotonics & Metamaterials
• Ultrafast magnetophotonics | Laboratory of Nanophotonics & Metamaterials
• Static and ultrafast nonlinear optics of metamaterials | Laboratory of

Journal Search . Welcome to the Search Page. You can find publications of our laboratory here. ... 1.Author . All Bochenkova A.V. Dobrogorskaya Ya.I. Ermilov A.Yu. Firsov D.A. Granovsky A.A. Grigorenko B.L. Moskovsky A.A. Nemukhin A.V. Skasyrskaya E.Ya. ... J. Phys. Chem.Phys.Lett. ... J.Chem. ... Science J.Chem. ... Theochem) J.Phys.Chem.A J.Phys.Chem.B Mendeleev Communications Molec.Phys. Phys.Rev.B Russian J. of Phys. Chem. ... All 2002 2001 2000 1999 1998 1997 1996 1995 1994 . ...

Еще в разделе: (Показать все результаты (>10) - lcc.chem.msu.ru/ )

The 3 rd Autumn forum of volunteers in MGU. Last weekend the chemical faculty of MGU held the Autumn forum of volunteers from Russian organization "World4U". The university students and visitors from abroad discussed actual problems of science and life. ... Lectures after V. Vinogradov to be read at the philological department. ... Students of historical department of the Moscow State University are thinking over the possibility to create a Museum of substitutes for modern money. ...

Еще в разделе: (Показать все результаты (>14) - www.rlcentre.com/ )

• "ABOUT RUSSIAN" - news about Russian language and Russia

... Prof, head of the laboratory of x-ray diffraction and crystal chemistry Home address: Russia, 115470, Prosp. ... 1964-1969 a student of Geological faculty MSU, department of crystallography 1969-1973 a post graduate student (scientific advisor academician N.V.Belov) 1974 Ph.D., speciality 'Crystallography and Crystalphysica', title of Ph.D. Thesis 'Crystal structures of (Na,Cd)-germanates' 1994 D.Sc., speciality 'Physical chemistry', title of D.Sc. ... E.L.Belokoneva, L.I.Leonjuk, V.S.Urusov. ...

Еще в разделе: (Показать все результаты (>19) - cryst.geol.msu.ru/ )

... Do those millions of sites and services provide useful information, or are they just "information pollution"? ... Abstract This is a review of electrochemical information and services available on the internet, and some evaluation of their usefulness for professionals, students, and the general public. ... Two examples are the "Internetchemistry" site [26] and the "Electrochemical Science and Technology Information Resource (ESTIR)", which lists over 1,000 links to electrochemistry-related sites [7]...

Еще в разделе: (Показать все результаты (>87) - electr003.chem.msu.ru/ )

• Elena V. Stenina:CV
• Boris I. Podlovchenko: Selected Publications
• Jurii M. Maksimov: Selected Publications

... I.N.Modin. ... Pervago E.V., Bobachev A.A., Modin I.N., Shevnin V.A. Report, presented at Annual SAGEEP conference, April 1995, Orlando, Florida, USA. 1 p. RESISTIVITY PROSPECTING IN URBAN REGIONS . ... Bobatchev A.A., Modin I.N., Pervago E.V., Sapognikov B.G., Shevnin V.A. Resistivity method, old and new . ... Volkov S.I., Kolarov D.L., Modin I.N., Muller A., Pervago E.V. Experience of aquatorial electrical survey at Brandenburg land in Germany. 3rd Meeting environmental and engineering geophysics....

Еще в разделе: (Показать все результаты (>63) - www.geol.msu.ru/ )

• Department of Lithology and Marine Geology - Publications
• Near-surface electrical prospecting laboratory at Moscow University

Q: Recently I read a book called ?C14-CrashЃ by Christian Bloess and Hans-Ulrich Niemitz (there is a summary in German with figures on . ... Briefly, the authors claim that the majority of the original assumptions made by Libby for the radiocarbon . ... directly calculated from a C14 value." ... such fractions are used for calibrations and dating. ... used for radiocarbon calibration. ... important after atmosphere reservoir - upper ocean. ... radiocarbon content in the atmosphere. ...

Еще в разделе: (Показать все результаты (>86) - hbar.phys.msu.ru/ )

• Appendix: Scaliger's List of Eras
• Robert R. Newton, The Secular Acceleration of the Earth's Spin
• Historical Eclipses

.

Еще в разделе: (Показать все результаты (>12) - www.chemport.ru/ )

• Real estate market monitoring october 2010 "медицинское имущество гражданской

... Society . ... Library . ... In the course of science popularization program MOIP shall set up a project called ?Public Lecture Hall?. In the course of the project holding we shall have meetings to be held as public lectures with our country?s scientists. ... In October 2015, the Society?s members, . ... We are working on the restoration and digitaziation of the Moscow Naturalist Society library. This will allow to avoid readers? direct contact.љ ... 2015 Moscow Society of Naturalists . ...

Еще в разделе: (Показать все результаты (>7) - www.moip.msu.ru/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... Group research focuses on chemistry, physics and materials science of colloidal semiconductor nanocrystals ( colloidal quantum dots ). Colloidal quantum dots from the chemical viewpoint are semiconductor nanocrystals stabilized by amphiphilic molecules. ... colloidal quantum dots as photosensitizers in solar cells . ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>36) - www.lssm.inorg.chem.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )