1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

Вычисление всех собственных значений в обобщенной проблеме собственных значений для вещественных симметричных матриц A и B . ... CALL PDSYGV1 ( IBTYPE, UPLO, N, A, IA, JA, DESCA, B, IB, JB, DESCB, W, WORK, LWORK, IFAIL, INFO) . ... определяет вид обобщенной проблемы собственных значений: . ... DESCA - . ... приведение обобщенной проблемы собственных значений к стандартной форме . ... вычисление всех собственных значений симметричной (эрмитовой) матрицы в линейной проблеме собственных значений . ...

Еще в разделе: (Показать все результаты (>45) - www.srcc.msu.ru/ )

. Feel free to write me: plusn@mars.biophys.msu.ru . Or call : tel +7-095-939 1963(work) . [Curriculum Vitae] ["Math. modeling" Group] . [Research Description] . Back to Math.Modeling Group Homepage .

Еще в разделе: (Показать все результаты (>6) - biophys.msu.ru/ )

• Galina Riznichenko Homepage

Sexual love", .. , «» . ... If it takes forever, I will wait for you.. ... What is love? ... k) s0L ( r) = 1 as ( ) d 3 xg (k ) ( x, r ) (k ) L ( x) - { ^ L0 - d 3rg (k ) ( x, r ) 0 ( r ) + (k) s0L ( r ) (n) } (k) L ( x ) = k (k) L ( x) = {Q ( t ) + n d 3r (n) ( r ; ) ( r )} / ( ) , ? ... VI. : 0,4 0,3 s, relative units - 0,2 0,1 0,0 0 1 2 3 s 4 5 dimensionless time, t/ Fig.3 1,1 1,0 0,9 0,8 s, relative units 0,7 0,6 0,5 0,4 0,3 0,2 0,1 0,0 -0,1 0 5 10 15 s - 1 20 dimensionless time, t/ Fig.4 , . ...

Еще в разделе: (Показать все результаты (>55) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/7_8_2009_supplement.pdf

... 1 Leninskiye Gory, Building 2, Room N8, CEDEX-1, Moscow, Russia 119991 . Moscow, ?Universitet? metro station (red line), intersection of Lebedeva street and Lomonosov avenue, Faculty of Physics, additional storey. ... From the security booth you have to call a lab employee awaiting you so he could fetch you to the lab. Citizens of other countries must get an additional permit to enter MSU buildings. ...

Еще в разделе: (Показать все результаты (>46) - engineering.phys.msu.ru/ )

Cameras · ­ · · · · · · · · ! MATLAB · MATLAB · Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film · Thin lens model: ­ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film · Thin ...

Еще в разделе: (Показать все результаты (>8) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt2_MATLAB_Workshop_SHORT.pdf

mode con codepage prepare=((866) C:\WINDOWS\COMMAND\ega3.cpi) mode con codepage select=866 keyb ru,,C:\WINDOWS\COMMAND\keybrd3.sys call c:\ms\ms.bat

Еще в разделе: (Показать все результаты (>13) - observ.pereplet.ru/ )

• http://observ.pereplet.ru/images/z/backupsql.txt

Polarisation properties of single-mode biphotons . Volume 35 (2005) . ... Pages 69-79 . L A Krivitskii , S P Kulik , G A Maslennikov , M V Chekhova . ... From the viewpoint of their polarisation properties, they represent qutrits, i.e., three-dimensional quantum systems, and are quite promising for quantum information applications. ... L A Krivitskii, S P Kulik, G A Maslennikov, M V Chekhova, "Polarisation properties of single-mode biphotons", Quantum Electron. ... Download PDF file (352 kB) . ...

Еще в разделе: (Показать все результаты (>72) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/papers/2011-pra-84-042108.pdf
• http://qi.phys.msu.ru/kulik/Papers/JETP_Lett_03.pdf
• http://qi.phys.msu.ru/papers/2009-epl-87-10008.pdf

List of publications . ... Moscow University Press. 160 pp. ... Shevchenko V.V. A Lunar Base. Moscow. ... Shevchenko V.V., Chikmachev V.I. Lunar Base - a Project of XXI Century. ... Shevchenko V.V., Pugacheva S.G., Dehktereva K.I. Brightness Characteristics of the Infrared and Visible Radiation of the Lunar Surface. ... Problems of Complex Research of the Moon. ... Solar System Research. ... Baydal G.M., Sizentzev G.A., Sotnikov B.I., Shevchenko V.V. Lunar Base Infrastructure and Lunar Resources. ...

Еще в разделе: (Показать все результаты (>74) - selena.sai.msu.ru/ )

• Бережной А.А.

The course is called Russian Civilizations Through American Eyes The course is a study of Russian history as it written and taught in the United States. The students discuss the different perceptions of Russian history from their knowledge and western interpretation of the same events or time frame. ... The classes meet for Second Year on Tuesday, 14:30-16:00 (Room 219) and 16:20-17:50 (Room 120). The Fourth year students meet Thursday, 16:20- 17:50 (Room 120). ...

Еще в разделе: (Показать все результаты (>14) - suny.msu.ru/ )

... Организация международной конференции . Маргиналии 2008: периферия культуры и границы текста. ... Конференция планируется как международная и ежегодная. ... Одна секция будет посвящена проблемам центра и периферии в культурном пространстве (при этом внимание обязательно будет уделяться и месту проведения конференции), а вторая ? более частной проблеме изучения периферии культуры. ... Мы считаем, что проблема центра-периферии является одной из ключевых проблем современной культуры. ...

Еще в разделе: (Показать все результаты (>7) - uni-persona.srcc.msu.ru/ )

... 2000 January 10 . Brown Sun Bubbling . ... Our Sun is an extremely large ball of bubbling hot gas , mostly hydrogen gas. The above picture was taken in a specific color of light emitted by hydrogen gas called Hydrogen-alpha . ... The energy source of our Sun is the nuclear fusion of hydrogen into helium deep within its core. Astronomers are still working to understand, however, why so few neutrinos are measured from the Sun's core. ... About APOD | ...

Еще в разделе: (Показать все результаты (>12) - www.arcetri.astro.it/ )

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Западная пивная компания приглашает на работу на должность System Network Administrator. ... Опыт работы от двух лет. ... Опыт работы с сетевым оборудованием Cisco. ... Западная пивная компания приглашает на работу на должность SAP Basis/DB2 Administrator. ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ... Комментарии и предложения присылайте на адрес info@cmc online.ru . ...

Еще в разделе: (Показать все результаты (>6) - www.cmc-online.ru/ )

. „Љ† єЉёј . Sigg Tobias /nb /00 02 ехэ?љсЕљ 2001 20:05:48 . **************Ecological Cooperation Project***************** . * zoology@fadr.msu.ru http://fadr.msu.ru/ecocoop/zoology * . ************************************************************* . I m just wonder what you call this bird in Russia . Buteo buteo vulpinus ?? . write the bird name whit russian letters . thank you if you can hyelp me #Tobias .

Еще в разделе: (Показать все результаты (>11) - www.ecocoop.ru/ )

• http://www.ecocoop.ru/zoology/archive1/messages/424.html
• http://www.ecocoop.ru/zoology/archive1/messages/425.html
• http://www.ecocoop.ru/zoology/archive1/messages/584.html

The Application and Characterisation of Nickel Nanoparticles Inside the Mesopores of MCM-41 Dennis J. Lensveld, J. Gerbrand Mesu, A. Jos van Dillen and Krijn P. de Jong Introduction The recent development of several structured mesoporous materials has received much attention from the field of catalysis. ... However, stability limitations of MCM-41 and related materials call for dedicated catalyst synthesis procedures. ... As a reference precursor the commonly used nickel nitrate was used. ...

Еще в разделе: (Показать все результаты (>20) - www.kge.msu.ru/ )

... only the sensors k in the simplest case); memory, in which evidence of the Interaction between the sensors and the identified object is imprinted, by forming the occasional imprint X of this object (it is not necessary to use the index of zone k, since other reception zones are not examined; and an inborn, a priori , (or, if ... Thus a new semiotic problem arises: the classification of objects and their patterns from possible sign situations in which two or more interpretors take part. ...

Еще в разделе: (Показать все результаты (>45) - old.philol.msu.ru/ )

• TRUE WRITER RECOGNITION

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Application of the change-point analysis to the investigation of the brain's electrical activity. ... Nonparametric Statistcal Diagnosis: Problems and Methods. ... These potentials were later proved to be the product of the superposition of the electrical activity of tens or hundreds of thousands of neuron cells (neurons) lying in the surface areas of the brain, which is called the cortex. ...

Еще в разделе: (Показать все результаты (>49) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Other prospects of the change-point based analysis
• Nonparametric approaches to the description of EEG piecewise stationary

... THE JULIAN AND MODIFIED JULIAN DATES . ... The calendar we use today, with its varying number of days in the month and complex rules governing leap years, is most inconvenient for this purpose, and so for much of the twentieth century astronomers have used the sequence of 'Julian day numbers' to denote the days (beginning with Greenwich mean noon) on which events occur. ... Today, modern algorithms for converting between Gregorian calendar dates and Julian day numbers perform the same function. ...

Еще в разделе: (Показать все результаты (>82) - hbar.phys.msu.ru/ )

• R.R.Newton, "Astronomical evidence..."
• Ответ Wally на книгу "Крах С14"
• R. R. Newton, "Two uses of ancient astronomy"

... Finance for Start-Up . ... Инновационная . структура МГУ . ... Обучение инновационному менеджменту . ... деятельности . ... Process of Forming a Company . ... Typical business development & equity scenario . ... Unfortunately, there is no single type of financing appropriate for all start-up companies and no single path to accessing money. ... 2005 Управление инновационной политики . и организации инновационной деятельности . МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>24) - innovation.msu.ru/ )

... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...

Еще в разделе: (Показать все результаты (>39) - biochem.bio.msu.ru/ )

• Effect of mutations in the beta5-beta7 loop on the structure and properties of