... site navigation | footer (site information) . IChO-2007 Participation Problems IChO RUSSIA Sponsors search . ... Moscow-1996 | ... Chemistry Department | ... Homepages of National Competitions Other International Science Olympiads Previous IChO's Miscellaneous Chemistry sites . ... Some fresh information is available. A letter from the President of 39th IChO . ... Information about post-Olympiad tour is now available . ... Information about guides of 39th IChO is now available. ...

Еще в разделе: (Показать все результаты (>2) - icho39.chem.msu.ru/ )

Analytical chemistry departmemt . Electrochemistry methods laboratory . ... GK 11.519.11.2041, Research and development of new systems using highly effective biosensors and electrochemical microscopy in colaboration with the Laboratory of Physical and Analytical Electrochemistry of the EPFL (Lausanne, Switzerland) 2012-2013 . ... GK 14.740.11.1374, Nano-analytical approaches for improving the efficiency of biosensors and development of the methods for a non-invasive clinical diagnosis, 2011-2013 . ...

Еще в разделе: (Показать все результаты (>25) - analyt.chem.msu.ru/ )

. [ <<Previous ] [ Index ] [ Next>> ]

Еще в разделе: (Показать все результаты (>41) - cellmotility.genebee.msu.ru/ )

• flower Untitled Document
• koluchki Untitled Document
• kust1 Untitled Document

Here is a list of previous events held by our Department. April 23, 2012 . Round Table Repeated Speech: Between a Commonplace and an Artistic Experiment held as a part of the Lomonosov Readings conference. ... Lecture Language, Culture and Hegemony: Rethinking the Politics of Culture in the єбє¬ntext of the Russian Revolution . ... Round Table . ... November 30, 2011 . ... Round Table Reading a Monument: A Memorial Place in the City (held as a part of the conference Polyphony of the City ). ...

Еще в разделе: (Показать все результаты (>2) - discours.philol.msu.ru/ )

Mailing List . Discussion club . Unresolved problems in the Study of Nature and Evolution of Human Language . ... Our goal is to consider some interesting and still unresolved problems of general theory of Human Language. ... Regularities of Human Language Evolution”. ... Universal, typological and stylistic features of Human Language Evolution; . ... Large Explanatory Dictionary of Russian (SPb: Norint, 1998. - 1536p.): preliminary evoluation of the dictionary (Russian letter "X") . ...

Еще в разделе: (Показать все результаты (>49) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics
• Footnotes
• Using Markov Chains for Identification of Writers

. Home . Main information . History . Gallery . People . Our Research . Photonics . Nonlinear spectroscopy . Nonlinear fiber optics . Attosecond optics . Neurophotonics . Nonlinear optics of ionized mediums . Fiber lasers . Collaborations . Publications . Conferences . Grants . Video . Contacts . Laboratory of photonics and nonlinear spectroscopy . Back to Category Overview . Previous . Next . Home Конференции Санкт-Петербург . Powered by Joomla! . Valid XHTML and CSS .

Еще в разделе: (Показать все результаты (>19) - photonicslab.phys.msu.ru/ )

• Gallery - Category: Конференции - Image: Казань ICONO/LAT 2010, дорога туда=)
• Gallery - Category: Конференции - Image: Казань ICONO/LAT 2010
• Gallery - Category: Конференции - Image: LALS, Oulu, Finland 2010

The Department of Talented Youth Affairs and Professional Orientation . ... XXXVI Beijing competition of scientific works of high school pupils . ... 17th April 2016 the Sixth Open School Championship in Economics will take place. ... The Open Championship is the first and the only nationwide Economic Competition, which takes place both in individual round and in team round. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>21) - talant.msu.ru/ )

• Law graduates turned in a good performance in the competition ?Foreign Direct

. Archives of the previous years . Archives . In Russian Main

Еще в разделе: (Показать все результаты (>99) - www.enzyme.chem.msu.ru/ )

SN 1999aa - A Third Supernova Discovery . Just 9 weeks after the discovery of SN 1998ey a suspect was found 1" east and 28" north from the centre of NGC 2595 on Feb.11.0166 U.T.. ... Further inspection of 6 images of NGC 2595 taken during Feb. and March 1998 showed no object at the position of the suspect. ... Beijing Astronomical Observatory recorded SN 1999aa on Feb. 11.6 and 12.6 UT, the first obervation being only 14 hours after the discovery. ... Back to Supernova 1999aa in NGC 2595 . ...

Еще в разделе: (Показать все результаты (>30) - www.rochesterastronomy.org/ )

• Nova in M31 2000 4
• Supernova 1999gp in UGC 1993

European Research Council Guidance Notes for preparing the Grant Agreement ERC Grant Schemes (Starting Grant ­ Advanced Grant) 24 July 2008 The Guide is published by the ERC on http://erc.europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu ) This guidance1 is provided for information purposes and easing cooperation. These notes do not replace legal sources but aim at assisting participants who are invited for preparation of the Grant Agreement following the evaluation of

Еще в разделе: (Показать все результаты (>28) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/ERC_rules.pdf
• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/fp7_rules.pdf

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>21) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf

V. V. KOZLOV Department of Mechanics and Mathematics Moscow State University, Vorob'ievy Gory 119899, Moscow, Russia E-mail: vako@mech.math.msu.su KINETICS OF COLLISIONLESS CONTINUOUS MEDIUM Received June 8, 2001 DOI: 10.1070/RD2001v006n03ABEH000175 In this article we develop Poincarґ ideas about a heat balance of ideal gas considered as a collisionless continuous medium. e We obtain the theorems on diffusion in nondegenerate completely integrable systems. ... d3 2 2 For the Maxwell distribution = 1. ...

Еще в разделе: (Показать все результаты (>121) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/d42/1511.02655v1.pdf
• http://ics.org.ru/upload/iblock/4bf/191-the-bifurcation-analysis-and-the-conley-index-in-mechanics_ru.pdf
• http://ics.org.ru/upload/iblock/702/176-the-dynamics-of-a-rigid-body-with-a-sharp-edge-in-contact-with-an-inclined-surface-in-the-presence-o_ru.pdf

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>50) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

Japan Student Services Organization (JASSO) Student Exchange Support Program Scholarship for Short-term Study in Japan [as of January 2016] This scholarship is available for qualified international students who are accepted by Japanese universities under student exchange agreements on a short-term basis. ... 7) Students who have a minimum GPA of 2.30 / 3.00 as calculated using JASSO's GPA calculation method shown below, based on a transcript from the previous academic year. ...

Еще в разделе: (Показать все результаты (>77) - phys.msu.ru/ )

• http://phys.msu.su/rus/research/conferences/more-2005/reichl-MORE-MC.pdf

... proposals* are presented by multinational consortia of organisations/individuals Proposals are evaluated by independent experts All proposal coordinators receive an Evaluation Summary Report Funding follows successful evaluation, selection and negotiation of grant agreement * except certain Support actions ··· 2 Who can participate · Three independent legal entities from three different EU Member States or Associated countries (presently ... 19 Proposals and projects in FP7 3. ...

Еще в разделе: (Показать все результаты (>50) - www.msu.ru/ )

• http://www.msu.ru/projects/amv/doc/h6_1_6_1_nom8_2.pdf

... Small heat shock protein Hsp27 prevents heat-induced aggregation of F-actin by forming soluble complexes with denatured actin. ... Our results show that formation of these complexes occurs upon heating and accompanies the F-actin thermal denaturation. ... It is supposed that Hsp27-3D binds to denatured actin monomers or short oligomers dissociated from actin filaments upon heating and protects them from aggregation by forming relatively small and highly soluble complexes. ...

Еще в разделе: (Показать все результаты (>26) - biochem.bio.msu.ru/ )

• Molecular identification of the enzyme responsible for the mitochondrial
• Synergetic inhibition of the brain mitochondrial NADH:ubiquinone oxidoreductase
• Cofilin weakly interacts with 14-3-3 and therefore can only indirectly

... Main page Catalogue Login . Your account | ... eMail Address: . Password: . Password forgotten? ... New Customer . Through your registration at our shop you are able to shop faster, know at any time the status of your orders and have always a current survey of your previous orders. I am a customer . ... Visitor orderer . I would like to order only as visitor . Through your order as visitor at our shop your dates are not stored and you do not have an account. ...

Еще в разделе: (Показать все результаты (>39) - www.bukivedi.ru/ )

• www.99ru.ru - www.99ru.ru
• www.99ru.ru - TURNER, J. 2958
• www.99ru.ru - Tina Turner 16015

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>22) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm