1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... The studied sample is a coarse-grained fluorite carbonatite of the second type composed of carbonate (~ 60 vol %), fluorite (~ 30%), K-feldspar (~ 5%), pyrite (2-3%), and barite (up to 1-2%). Carbonate is represented by calcite with elevated contents of љ Mn љ and FeO. ... The primary melt inclusions and syngenetic crystalline inclusions were revealed in fluorite, K-feldspar, and pyrite from fluorite carbonatite. ... Fluoride minerals are represented by fluorite and villiaumite. ...

Еще в разделе: (Показать все результаты (>113) - geo.web.ru/ )

• Calendar Converter
• Trusov Sergey's homepage The influence of boundary layer effects on the melt
• Вторая находка в мире архейских офиолитов! - Все о Геологии (geo.web.ru)

... Публикации . ... С.В. Балахонов, Д.С. Лучинкин, М.В. Ефремова, Б.Р. Чурагулов, Ю.Д. Третьяков . ... Hydrothermal synthesis of a novel phase of vanadia-based nanowhiskers" . ... Ю.В. Коленько, А.А. Бурухин, Б.Р. Чурагулов, Н.Н. Олейников . ... Мескин П.Е., Баранчиков А.Е., Иванов В.К., Кистерев Э.В., Бурухин А.А., Чурагулов Б.Р., Олейников Н.Н., Комарнени Ш., Третьяков Ю.Д. "Синтез наноразмерных порошков Co3O4 в гидротермальных условиях с одновременным ультразвуковым воздействием" . ...

Еще в разделе: (Показать все результаты (>21) - www.inorg.chem.msu.ru/ )

• Group of Hydrothermal Synthesis :: Articles
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... Loskutov, and E. V. Ryadchenko Presented by Academician A.R. Khokhlov April 22, 2005 Received April 26, 2005 The problem of the identification and biological significance of chromosome fragments and complete genomes is approached on the basis of the representation of a sequence of DNA nucleotides as a two-dimensional walk. ... However, as applied to DNA, functional and structural fragments of a chromosome may be distinguished by a typical walk "pattern" only for a sufficiently large number of units....

Еще в разделе: (Показать все результаты (>44) - chaos.phys.msu.ru/ )

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/rcx_advices.pdf

... 4, 1997 LETTERS TO THE EDITOR HETEROCYCLES WITH A BRIDGE NITROGEN ATOM. ... NOVEL SYNTHESIS OF THE OXAZOLO[3,2-a]PYRIDINIUM CATION BY RECYCLIZATION OF A MESOIONIC PRECURSOR: CONFIRMATION OF A COMPUTER PREDICTION E. V. Babaev and I. A. Oriova Mesoionic heterocycles as a rule are unstable. ... Thus on boiling in water, 2-oxo-3-acyloxazolo[3,2-a]pyridines are c6nverted to N-(~-oxoalkyl)-2-pyridones. ... We found that when water is added to a solution of 2-oxo-3-benzoyloxazolo[3,2-a]pyridine (I) in cone...

Еще в разделе: (Показать все результаты (>107) - www.chem.msu.ru/ )

• http://www.chem.msu.ru/eng/misc/babaev/papers/152e.pdf
• http://www.chem.msu.ru/eng/misc/babaev/papers/149e.pdf
• http://www.chem.msu.ru/eng/misc/babaev/papers/150e.pdf

... A new environmental -economic policy Low environmental financing Boris Gryzlov: the ruling party on environmental problems Sociological survey of the state of environment in Russia The outcome of Rosprirodnadzor in 2010 Environmental policy in the Northwest Federal District Fundamentals of Ecological Policy of ... Environmental policy in the Northwest Federal District Heads of territorial bodies of Rosprirodnadzor in the Northwest Federal District summed up for 2010. ...

Еще в разделе: (Показать все результаты (>115) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/5_11.pdf
• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/3_11.pdf
• hmokn

European Research Council Guidance Notes for preparing the Grant Agreement ERC Grant Schemes (Starting Grant ­ Advanced Grant) 24 July 2008 The Guide is published by the ERC on http://erc.europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu ) This guidance1 is provided for information purposes and easing cooperation. These notes do not replace legal sources but aim at assisting participants who are invited for preparation of the Grant Agreement following the evaluation of

Еще в разделе: (Показать все результаты (>28) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/Work_programme_2011.pdf
• http://ideas.msu.ru/docs/guide_for_applicants_StG_2012.pdf

... President George W. Bush Department of Education Strategic Goals: Goal One: Create a Culture of Achievement Create a culture of achievement by effectively implementing the president's plan, No Child Left Behind, and by basing all federal education programs on its principles: accountability, flexibility, expanded parental options, and doing what works. ... Goal Six: Establish Management Excellence Create a culture of accountability throughout the Department of Education. ... accountability | ... line...

Еще в разделе: (Показать все результаты (>2) - www.edst.msu.ru/ )

• http://www.edst.msu.ru/conf/docs/Bologne.doc

... Seminars . ... Group 417 [ PDF ] Students are expected to attend lectures and seminars which is the standard forum for class communication. ... Some of the homework problems might appear on the tests and the exam. ... Your class grade total percentage is given by 40% seminar and homework, 25% first test and 35% second test. ... Students with the class grade 5 and 4 may get a final course grade without a final exam, but only upon the recommendation of seminar assistants. ... Test 1 [ PDF ] . ...

Еще в разделе: (Показать все результаты (>26) - nanofluidics.phys.msu.ru/ )

... A p P EC Astropar ticle Physics for Europe · Cosmic rays: A large array for the detection of charged cosmic rays ( Auger North) · Gamma rays: A large array of Cherenkov Telescopes for detection of cosmic high energy gamma-rays ( CTA ) · High energy neutrinos: A cubic kilometre-scale neutrino telescope in the Mediterranean (KM3NeT) · Dark matter search: Ton-scale detectors ... A p P EC Astropar ticle Physics for Europe · Cosmic rays: ­ ­ ­ ­ ­ AMS detector launched. ...

Еще в разделе: (Показать все результаты (>2) - tunka.sinp.msu.ru/ )

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Full-time programs . ... Partners . ... All partners . ... Attraction of international students, development of cooperation with foreign partner universities is one of the priorities for the Faculty of Journalism. ... Foreign citizens can enter the Faculty of Journalism on a contract basis according to specific rules. ... Faculty of Journalism provides foreign applicants with a standard visa invitation. ...

Еще в разделе: (Показать все результаты (>14) - www.journ.msu.ru/ )

... Master's Programme . ... On-line консультант . ... Master s Programme Enterprise Resource Management System has been developed basing on methodology from SAP, Oracle, Microsoft Companies, as well as the experience of national higher school and international universities. The key objective (mission) of the Programme is to educate professionals in the organization and implementation of projects aimed at deployment and maintenance of ERP systems at domestic enterprises. ...

Еще в разделе: (Показать все результаты (>4) - erp.cmc.msu.ru/ )

... MECHANICS Free and Controlled Motion of a Body with a Moving Internal Mass through a Fluid in the Presence of Circulation around the Body E. V. Vetchanina, b and A. A. Kilinc Presented by Academician V.V. Kozlov April 20, 2015 Received April 27, 2015 Abstract--The free and controlled motion of an arbitrary two dimensional body with a moving internal mass and constant circulation around the body in an ideal fluid is studied. ... Bifurcation diagram of the free system. ...

Еще в разделе: (Показать все результаты (>91) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/250/188-an-extended-hamilton-jacobi-method_ru.pdf
• http://ics.org.ru/upload/iblock/b6d/195-dynamics-and-control-of-an-omniwheel-vehicle_ru.pdf
• http://ics.org.ru/upload/iblock/51b/175-remarks-on-integrable-systems_ru.pdf

Next: Up: autoref Previous: autoref . ... A.S. Belyaev, E.E. Boos, L.V. Dudko ``Single top quark at future hadron colliders: Complete signal and background study'', Phys.Rev. D59 (1999) 075001. ... A. Belyaev, E. Boos, L. Dudko, ``Single top quark and light Higgs boson at Tevatron'' Talk given at 32nd Rencontres de Moriond: Electroweak Interactions and Unified Theories, Les Arcs, France, 15-22 Mar 1997, p. 37, hep-ph/9804328 ( http://xxx.itep.ru ). ... Up: autoref Previous: autoref Lev Doudko . ...

Еще в разделе: (Показать все результаты (>7) - top.sinp.msu.ru/ )

• Bibliography

. If you see this page, the nginx web server is successfully installed and working on Debian. Further configuration is required. For online documentation and support please refer to nginx.org . Please use the reportbug tool to report bugs in the nginx package with Debian. However, check existing bug reports before reporting a new bug. Thank you for using debian and nginx.

138. Список слов, необходимых для сдачи экзамена по английскому

139. Помогите написать диплом, пожалуйста!!!!

140. http://qilab.phys.msu.ru/papers/Laser-Phys-Lett-2004.pdf