astro-ph/0304458 Оптический Эксперимент по Гравитационному Линзированию. ... Eclipsing Binary Stars in the Large Magellanic Cloud) . ... Authors: Nils Bergvall et al. astro-ph/0304235 Для галактик, ярких в субмиллиметровом диапазоне, среднее красное смещение равно 2.4 (A median redshift of 2.4 for galaxies bright at submillimetre wavelengths) . ... Authors: Adam J. Burgasser et al. astro-ph/0304536 Антропные предсказания для масс нейтрино (Anthropic predictions for neutrino masses) . ...

Еще в разделе: (Показать все результаты (>455) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/2002-07_2003_03/rad.html
• http://xray.sai.msu.ru/~polar/sci_rev/2002-07_2003_03/sun.html
• Новости науки

... download [ 61679 ] . Effects of the Seafloor Topography on Tsunami Generation Explored for the Messina 1908 tsunami through 2-D finite element modeling . ... What Evidence Exists for Paleotsunami Triggered by Local Earthquakes in the Wellington Region of New Zealand? ... Didenkulova I. I. and Pelinovsky E. N. (Russia) . ... Near-Shore Oceanic Earthquakes: Application of Acoustic Methods to Detect Earthquake Precursory Phenomena and Possible Improvements of Tsunami Warning Systems . ...

Еще в разделе: (Показать все результаты (>28) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Official information

... 2006, . ... 424-436 Rybakov A. A. at al -- MCE -- 2006, v. 2, p. 424-436 , , . ... Mathematical Models In Biology, Ecology And Chemistry ek ( e k *e j = k j ) (1). ek ( ), . ... Phys. --1989. Vol. ... Amitrano C., Berry R.S. Probability distributions of local Liapunov exponents for small clusters // Phys. Rev. Lett. ... Chaotic behavior of triatomic clusters // Phys. Rev. A. -- 1997. ... Yurtsever E. Angular-momentum-driven chaos in small clusters // Phys. Rev. A. -- 1998. ...

Еще в разделе: (Показать все результаты (>19) - beams.chem.msu.ru/ )

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>5) - composite.msu.ru/ )

Heat transfer intensification on surfaces with 'eddy generating' relief at supersonic velocity of incident flow . ... Temperature field on plates with 'eddy generating' relief (dimples and projections) М=3.1 . Local coefficients of heat transfer distribution on plates with 'eddy generating' relief (dimples and projections) and a smooth plate flown over by supersonic air stream M=3 . ... Temperature distribution during flowing of supersonic stream over a single dimple . ...

Еще в разделе: (Показать все результаты (>11) - termogaz.imec.msu.ru/ )

• MAU_main_e
• AR-2 main_e
• stratif_E

... The latter should be taken into account and carefully modeled as a fluid-structure interaction (FSI) problem. A patient- specific FSI analysis is impossible because it predicts only estimated hemodynamic features which are based on assumptions regarding material properties. The objective of this study is to develop a new methodology that assimilates medical imaging data for quantitative hemodynamic data extraction. ...

Еще в разделе: (Показать все результаты (>34) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/lectures/index.html

... В работе рассматривается двухмерная математическая модель лесных пожаров, приводится алгоритм численного решения и результаты тестовых расчетов. ... В работе [1] была предложена двухмерная модель лесных пожаров, построенная методом осреднения исходных трехмерных уравнений газовой динамики по высоте слоя лесных горючих материалов, который рассматривается как одноярусная двухфазная (газовая и твердая фазы) двухтемпературная реакционноспособная среда. ... Газовая фаза: . ... коэффициент диффузии, . ...

Еще в разделе: (Показать все результаты (>48) - www.library.biophys.msu.ru/ )

• МОДЕЛЬ ДИНАМИКИ БИОМАССЫ ЖИВОГО НАПОЧВЕННОГО ПОКРОВА В ЛЕСУ
• ЖИЗНЕСПОСОБНОСТЬ ПОПУЛЯЦИЙ ПРИ ИМПУЛЬСНОМ ВОЗДЕЙСТВИИ ТОКСИКАНТОВ
• SimpMeth

e-mail: eka-dobrenkova@yandex.ru) .., . e-mail: elishev@list.ru) , , , , the youth policy, the public youth policy, models of a public youth policy, "konfessional" the public youth policy . ... Konfessional the public youth policy should be comprehended as the new, fourth model of a public youth policy representing the youth public policy of various types of the religious organisations and associations; as traditional faiths (Orthodoxy, Islam, the Buddhism and a Judaism), and new growths. ...

Еще в разделе: (Показать все результаты (>35) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2011/3/08.pdf
• http://www.socio.msu.ru/vestnik/archive/2013/3/09.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/4/08.pdf

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6961) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage

Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, Department of the English Language Abstract Categorical Models of Quantum Mechanics By Alexander Zapryagaev, group 304 21 October 2014 The report deals with the axiomatic approach to the phenomena of quantum computation and algorithms. ... Finally, the logic behind quantum operations is discussed: it is revealed that the ideas of quantum algorithms have a strong connection to Jean-Yves Girard's linear logic. ...

Еще в разделе: (Показать все результаты (>17) - www.eng.math.msu.su/ )

... Course Name . ... Software Development for Computational Problems . ... Prof. Fedor S. Zaitsev . Data Analysis Methods . ... Computational Physics and Nanotechnology . ... Assoc. Prof. Igor N. Inovenkov . Mathematical Models for Dynamic Processes . ... Prof. Igor V. Zotov . ... One-Dimensional Problems of Mathematical Physics . ... Two-Dimensional Problems of Mathematical Physics . ... Maple for Mathematical Physics Problems . ... Source URL: http://ani.cs.msu.su/en/courses . ...

Еще в разделе: (Показать все результаты (>9) - ani.cs.msu.su/ )

• The ASR Department at the CMC Faculty of Lomonosov MSU

... Kirk Hatfield . ... J. Hydrol. In Review). Klammler H., K. Hatfield, and M. Annable. ... Newman, M., K. Hatfield, J. Hayworth, P.S.C. Rao, and T. Stauffer. ... Hatfield, K., M. Annable, J. Cho, P.S.C. Rao, and H. Klammler. ... Brooks, M., M. Annable, P.S.C. Rao, K. Hatfield, J. Jawitz, W. Wise, A. Wood, C. Endfield. ... Brooks, M.C., M.D. Annable, P.S.C. Rao, K. Hatfield, J.W. Jawitz, W.R. Wise, A.L. Wood, and C.G. Enfield. ... Hatfield, K., M.D. Annable, S. Kuhn, P.S.C. Rao, and T. Campbell. ...

Еще в разделе: (Показать все результаты (>109) - mgumus.chem.msu.ru/ )

• MGUMUS -- Current projects
• MGUMUS -- First International Conference on Humics-based Innovative
• MGUMUS -- Первая международная конференция по гуминовым инновационным

... Master Degree in Geology . Master Degree in Management . Master Degree in Chemistry . ... 29 марта 2016 г. День открытых дверей Высшей школы инновационного бизнеса . ... T he goal of this Master Degree program is to educate specialists with the knowledge of the newest technologies of geological study, modeling and development of deposits, advanced scientific methods of seismic and geophysical exploration, geophysical well-logging, production enhancement, etc. ...

Еще в разделе: (Показать все результаты (>6) - www.hsib.msu.ru/ )

... Bachelor Program . Master Program . ... The Department of Operations Research . ... researchers specialized in mathematical models and methods of economic regulations . ... possess a profound knowledge in the field of e со nometrics, risk theory, actuarial and financial mathematics, the theory of games, operations research, economic regulation on micro and macro levels . ... can use modern computer technologies in order to construct models and solve optimization problems . ... exam . ... test . ...

Еще в разделе: (Показать все результаты (>21) - io.cmc.msu.ru/ )

... Publications . Journals . ... Gonchenko A. S. , Gonchenko S. V. , Kazakov A. O. Richness of Chaotic Dynamics in Nonholonomic Models of a Celtic Stone . ... Gonchenko A. S. , Gonchenko S. V. , Kazakov A. O. On some new aspects of Celtic stone chaotic dynamics . ... Gonchenko A. S., Gonchenko S. V., Kazakov A. O., On some new aspects of Celtic stone chaotic dynamics, Russian Journal of Nonlinear Dynamics, 2012, vol. 8, no. 3, pp. ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>119) - ics.org.ru/ )

• Institute of Computer Sciences - Journals

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>40) - biochem.bio.msu.ru/ )

• Human pro-B-type natriuretic peptide is processed in the circulation in a rat
• [Search for chaperon-like anticataract drugs, the antiaggregants of lens
• Expression of NMDA receptors in multipotent stromal cells of human adipose

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Mathematical modeling of the accuracy characteristics in problems of precision quantum tomography of biphoton states?, ... A model that approximately takes into account instrumental errors in problems of precision reconstruction of quantum states is considered. ... Various sources of instrumental errors that affect the reconstruction accuracy of quantum states are mathematically modeled. ...

Еще в разделе: (Показать все результаты (>88) - qi.phys.msu.ru/ )

... California Department of Education (1985), Mathematics framework for public schools, kindergarten through grade twelve. ... California Department of Education (1992), Mathematics framework for California public schools, kindergarten through grade twelve. ... California Department of Education (February 5, 1998), The California mathematics academic content standards. [ http://www.cde.ca.gov/board.html ] . ... NCTM (1998), California mathematics academic content standarts for grades K-12. ...

Еще в разделе: (Показать все результаты (>296) - www.nature.web.ru/ )

• Первая за последние 10 лет книга по компьютерному моделированию динамических

... Geography of World Economy . ... Recreational Geography and International Tourism . ... World Data Systems functions under the sponsorship of the International Council for Science ICSU since 1956 (until 2008 in the form of two structures - World Data Centers and the Federation of Astronomical and Geophysical Data Analysis Services). ... Map "The population of the Russian Federation", scale 1:7 500 000, Russian Geographical Society, Faculty of Geography Moscow State University, OOO "FOC", 2014. ...

Еще в разделе: (Показать все результаты (>50) - eng.geogr.msu.ru/ )

• Department of Meteorology and Climatology
• Complex Mapping
• ICCE events

MSU . Science Park . ... Prototyping center . Engineering formula . ... Center for Youth Innovation Creativity and Prototyping at Moscow State University Science Park is focused on work with pupils and students to familiarize them with the capabilities of modern equipment and engaging in scientific and technical activities. ... The main goal of the Center - provide opportunities for children and young people to fulfill themselves in scientific and technical work. ... JSC "MSU Science Park" . ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )