Literature . ... Computers and Statistical Data Analysis. ... In Russian. ... Basic notions and methods of applied statistical analysis and usage of leading Russian and American statistical software tools: STADIA, STATGRAPHICS. ... The second edition has much more detailed depiction of temporal series analysis methods, review of statistical packages for Windows and recommendations on their choosing. ... Kulaichev A.P. Data Analysis Methods And Tools for Windows . ... In English and In Russian. ...

Еще в разделе: (Показать все результаты (>2) - statsoft.msu.ru/ )

... 6 4, 53^57, 20 01 The Local Plasma Frequency Approach in Description of the Impact-Parameter Dependence of Energy Loss V. A. Khodyrev* Institute of Nuclear Physics, Moscow State University, Moscow 11989 9, Russia Received October 26, 2 0 0 0; revised ... The local energy loss is determined by the induc ed electron current and the intensity of the projectile ў eld at a given point. ... Fig. 3 shows also the results of calculation of DE b based on the static electron gas model (ek; o from Eq. ...

Еще в разделе: (Показать все результаты (>95) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LAS/Nimb212_03_96Teplova.pdf
• http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysB33_2000_5045Khodyrev.pdf

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>12) - belyakov.imec.msu.ru/ )

• Anton O. Belyakov

... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>43) - uranus.sai.msu.ru/ )

Calcareous paleosols are widely distributed throughout the arid and semi arid regions of the world. These paleosols have been described from virtually every continent of the world, yet there is no internationally agreed upon nomenclature for the description of the horizons present within them. ... This abstract proposes the adoption of a universally agreed-upon system of horizon designation and gross morphological description of calcareous paleosols. ... Soil Science, 101, 347-360. ...

Еще в разделе: (Показать все результаты (>255) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Services - Portfolio
• NEW FARM RESOLUTION (From RUSAG conference)

V.V.Pipin, D.D.Sokoloff, I.G. Usoskin, Variations of the solar cycle profile in a solar dynamo with fluctuating dynamo governing parameters, Astron. Astrophys., A26, 11 pages, 2012. ... Solar cycles vary in their amplitude and shape. ... We related the cycle-to-cycle variability of solar activity to fluctuations of solar dynamo drivers and primarily to fluctuations in the parameter responsible for the recovery of the poloidal magnetic field from the toroidal one. ...

Еще в разделе: (Показать все результаты (>80) - srcc.msu.ru/ )

• Kazakevich, Olga. Documentation and description of the Northern Selkup local
• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

The purpose of the space-physics lab exercises is to introduce the students to the methods of the measurements, to the modern conception of near-Earth space structure and the physical processes and phenomena occured in it. ... At present the reasearches and the teachers of the University and of other institutes participating in the project continue development of the the special space-physics lab exercises, and they are interested in your ideas concerning the future exercises. ...

Еще в разделе: (Показать все результаты (>41) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006
• University Satellites and Space Science Education '2006 I

... Полная версия этой страницы: Higgs boson lighter than previously predicted . Студенческий форум Физфака МГУ > Наука физика > Другое . ... The new W-mass value leads to an estimate for the mass of the yet-undiscovered Higgs boson that is lighter than previously predicted (<114 ГэВ, см. картинку ниже, доверительный интервал 68%) , in principle making observation of this elusive particle more likely by experiments at the Tevatron particle collider at Fermilab. ...

Еще в разделе: (Показать все результаты (>587) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > семинар Г. т'Хофта в Стекловке
• семинар Г. т'Хофта в Стекловке - Студенческий форум Физфака МГУ
• Студенческий форум Физфака МГУ > Каррент мьюзик

... About 70 scientific papers. The theory of square parachute is created, describing distribution of parameters of shape, tension and resistance to airflow of canopy in steady-state condition for various sets of suspension line lengths and air-permeability. ... The practical recommendations for optimal parachute application are submitted. ... It is discovered experimentally that a character of pressure distribution for a square canopy depends on a particular choice of suspension line lengths. ...

Еще в разделе: (Показать все результаты (>6) - margaret.imec.msu.ru/ )

• Education
• Air-Permeability Influence on Pressure Distribution Character
• On Square Parachute Differential Equations

... Ummidia gandjinoi (Andreeva, 1968) Figs 16. ... Color in alcohol: carapace, palps and legs dorsally hazelnut- brown ; legs along medial line and carapace along thoracic fovea and grooves with slightly paler pattern; eye tubercle dark brown , with blackish- brown spots surrounding AME and all lateral eyes; chelicerae uniformly reddish brown ; most (central) part of sternum, coxae IIV and legs IIIIV ventrally deep brownish yellow; sternal edges, labium, maxillae, palps and legs ... III. ...

Еще в разделе: (Показать все результаты (>1455) - zmmu.msu.ru/ )

• http://zmmu.msu.ru/files/images/spec/Russ%20Ent%20J/ent19_3%20183_185%20Bekchiev.pdf
• http://zmmu.msu.ru/files/images/spec/Russ%20Ent%20J/ent21_2%20197_201%20Uchmanski.pdf
• http://zmmu.msu.ru/files/images/spec/Russ%20Ent%20J/ent22_1%20075_076%20Vikhrev%20for%20Inet.pdf

Special courses for the students of Physics Faculty, specialized at the Department. ... 32 hours, 6-th term . ... A review of characteristic ferroelectric and magnetic materials is given. ... The anomalies of physical properties in the phase transition in accordance with the crystal symmetry. ... Solid state physics . ... It is assumed that student will get knowledge about magnetic properties of such systems as molecular, clusters, nano-particles, surfaces, ultra thin films, mono- and multilayers. ...

Еще в разделе: (Показать все результаты (>7) - ferro.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Publications . ... Number of publications 0 . ... Publication type . ... Borisov A. V. , Kazakov A. O. , Sataev I. R. The Reversal and Chaotic Attractor in the Nonholonomic Model of Chaplygin?s Top . Regular and Chaotic Dynamics, 2014, vol. 19, no. 6, pp. ... Borisov A. V., Kazakov A. O., Sataev I. R., Regular and Chaotic Attractors in the Nonholonomic Model of Chapygin's ball, Russian Journal of Nonlinear Dynamics, 2014, vol. 10, no. 3, pp. ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>111) - ics.org.ru/ )

... Surkova G.V., Koltermann K.P., Kislov A.V. Method of forecasting storm conditions for the Black Sea under climate changes Mathematic modeling (climatic models or models of the Earth s climatic system) is used to forecast variations of the state of the environment under climate changes. ... Statistical data of storm conditions in a number of sites of the Black Sea coast was analyzed and their changes were forecasted for the middle of the 21st century under a specific scenario of climate warming. ...

Еще в разделе: (Показать все результаты (>167) - www.geogr.msu.ru/ )

• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• CONTENTS ?6 - 2011
• CONTENTS ?3 - 2009

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>76) - sai.msu.ru/ )

... Probe flash (energy/duration) . ... 0.01 J / 0.01 ms . ... Submersible unit (dimension/weight) . Power supply unit (dimensions/weight) . ... 300 x 300 x 50 mm / 1 kg . ... Power supply . ... The complete set of PrimProd fluorometer consists of the following mainframes: submersible probe, 12 DC on-board block power supply, IBM-compatible computer, connecting cables and cable-rope. ... Submersible probe. ... On-board power block provides the necessary voltage (42 V) supply at the submersible probe. ...

Еще в разделе: (Показать все результаты (>9) - www.biophys.msu.ru/ )

• (Chlorophyll Fluorescence in vivo: A Theory

... RELEC Mission: Relativistic ELECtron Precipitation and TLE Study on-board Small Spacecraft . ... Spacecraft mass: 283 kg. ... The Program of RELEC workshop July, 28, 29, Moscow more details.. ...

Еще в разделе: (Показать все результаты (>4) - vernov-relec.sinp.msu.ru/ )

: .. , . . , ., (e-mail: mchedlova@yandex.ru) , , , , religion, politics, secularism, religious identity, epistemology . , , , . This article examines the problem of interpretation of political reality in the light of increasing importance of the religious factor. The focus is on the need to find new epistemological framework different from the traditional secular paradigm, the new configurations of secular and religious, the religion as an identification parameter.

Еще в разделе: (Показать все результаты (>16) - vestnik.socio.msu.ru/ )

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>18) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/TTravouillon_TMT_site_testing_site2010.pdf