... Bohm limit DB=vrg/3: Emax Emax ush 0.3 Ze B Rsh c 1014(B/Bism) Z eV B Hillas criterion ! ... Voelk 2000; Kang Jones 2006) - Bohm diffusion in amplified magnetic field B2/8 = 0.035 u2/2 ( Voelk et al. 2005 empirical; Bell 2004 , Zirakashvili VP 2008 theoretical) - account for Alfvenic drift w = u + Va upstream and downstream - relative SNR rates: SN Ia : IIP : Ib/c : IIb = 0.32 : 0.44 : 0.22 : 0.02 Chevalier 2004 , Leaman 2008, Smart et al 2004, Berezinsky et al 2006 Das et al. ...

Еще в разделе: (Показать все результаты (>8) - tunka.sinp.msu.ru/ )

... Class . ... public class MessageBox . ... showConfirm (java.awt.Frame parent, java.lang.String msg) . static void . ... Method Detail public static void showInfo (java.awt.Frame parent, java.lang.String msg) . public static void showError (java.awt.Frame parent, java.lang.String msg) . public static void showWarning (java.awt.Frame parent, java.lang.String msg) . ... public static java.lang.String showInput (java.awt.Frame parent, java.lang.String msg, java.lang.String[] options) . ...

Еще в разделе: (Показать все результаты (>83) - angel.cs.msu.su/ )

• ClientMethod
• FourierNFDialog
• InterpolationDialog

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Специалисты из King's College London впервые выделили в крови 22 молекулярных биомаркера старения. ... Один из этих метаболитов - С-гликозил триптофан (C-glyTrp) - оказался особенно важен для понимания механизмов, лежащих в основе старения, а его роль стала неожиданной для авторов исследования. ... One particular metabolite, C-glycosyl tryptophan (C-glyTrp), correlated strongly with age (beta = 0.03, SE = 0.001, P = 7.0 ...

Еще в разделе: (Показать все результаты (>303) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "Новые данные о геропротекторах"

... 3D magnetosphere . ... Data . ... Magnetosphere . ... Magnetic field at the selected point Module of the Magnetic field distribution along Sun-Earth line Noon-Midnight magnetosphere structure . ... Point coordinates, where magnetic field will be calculated: . ... Magnetic field at MD outer edge . ... Magnetic field at TC inner edge . ... Distance to external edge of MD . ... Distance to inner edge of MD . ... Magnetopause stand-off distance . ... Distance to inner edge of geotail current sheet . ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )

• Index of /models/temp
• Index of /models/database/db/001108
• Index of /models/database/db/010128

International Laser Center of MSU . ... Education . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... In our work we have obtained analytical expressions, which describe the distributions of intensity and polarization in the cross-section of a second-harmonic (SH) light beam. It is found that the polarization state drastically changes along the cross-section of the signal light beam. ...

Еще в разделе: (Показать все результаты (>60) - ilc.phys.msu.ru/ )

• Публикация
• Grant detail

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )

PHYSICAL REVIEW A, VOLUME 62, 022718 Kinetic energy release distributions in the Coulomb explosion of N2 molecules induced by fast, highly-charged- ion impact B. Siegmann,1 U. Werner,1 R. Mann,2 N. M. Kabachnik,1,* and H. O. Lutz1 2 ЕЕ Е Fakultat fur Physik, Universitat Bielefeld ... Schwerionenforschung (GSI), D-64291 Darmstadt, Germany Received 15 February 2000; published 20 July 2000 1 The dissociation of molecular ... ions of Xe44 ( In the present paper we discuss fast collisions in the 1 . ...

Еще в разделе: (Показать все результаты (>101) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/PhysRevA64_2001_023201NMKab.pdf
• http://danp.sinp.msu.ru/LAS/Nimb256_07_21Teplova.pdf
• http://danp.sinp.msu.ru/LIIWM/Nimb245_06_28Balashova.pdf

Paleosoils: Indicators of Environmental Changes in the Holocene . ... According to Dokuchaev V.V. "the soil is the mirror of landscape". The dependence between soil formation processes and climatic changes (thermal conditions, humidity) has been established. ... The experience gained on studying buried soils of Russia and the CIS countries in the Holocene shows that paleoclimatic conditions can be reconstructed by buried soils for various the Holocene chronocuts rather accurately. ...

Еще в разделе: (Показать все результаты (>133) - www.fadr.msu.ru/ )

• An International Consensus on Calcareous Paleosol Classification
• Abstracts of Paleopedology Symposium and Poster Session at XY INQUA Congress in
• NEW FARM RESOLUTION (From RUSAG conference)

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>17) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... Virtual work . ... A piecewise polynomial defined on this partition is a polynomial of low degree on each element . ... Partitioning a matrix in rows and columns . ... Matrix partitioning . Matrix partition . ... Partition of the matrix into blocks . Partitioning the matrix into blocks . ... Column partition of a (the) matrix . Column partitioning of a (the) matrix . ... Row partition of a (the) matrix . Row partitioning of a (the) matrix . ... Разложение в . ... Arcsine distribution . ...

Еще в разделе: (Показать все результаты (>57) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/24.htm
• Параллельные программы. ЛИТЕРАТУРА

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

. Fig. 3. Dependence of km on surface irradiance I(0). Solid and dashed lines shows km value averaged over 23 stations the Baltic Sea and band of standard deviation accordingly. Designations: 1 - km > 7*10 -5 ; 2 - km < 7*10 -5 . Fig. 4. The dependence of I 1/2 m on the average chlorophyll a content in water column and polynomial regression of this dependence (A). Histogram of distribution of the ratio of I 1/2 m to results of polynomial regression (B).

Еще в разделе: (Показать все результаты (>16) - www.biophys.msu.ru/ )

• Как отмечалось выше, обилие (по Fo) и фотосинтетическая активность

... Version 2.0 modifies version 1.8 to include explicit statistical estimates for similarity scores based on the extreme value distribution. ... TFASTA with ktup=2 is about as fast as a DNA FASTA with ktup=4, and is substantially more sensitive. (also reads the GENBANK library) TFASTX Search DNA library for a protein sequence by translating the DNA sequence to protein in all six frames (three forward frames with the -3 command line option) calculating similarity scores that allow frameshifts. ...

Еще в разделе: (Показать все результаты (>178) - www.genebee.msu.ru/ )

• Notes on searching by similarity
• Impact Factors of Scientific Journals in 1999
• GeneBee ClustalW 1.83

... Michail A. Ormont Research activity of the group is related to the theory of transport and optical properties of disordered semiconductors, in particular, the disorder effects in systems of reduced dimensionality. Studies of phonon-assisted hopping transport include the theory of hopping in quasi-one- and quasi-two-dimensional systems and hopping thermoelectric effects. ... Anisotropy in hopping conductivity of quasi-one-dimensional systems. ... Electronic Superstructures in Doped Superlattices. ...

Еще в разделе: (Показать все результаты (>82) - scon155.phys.msu.su/ )

• Effect of Coulomb Interactions on the Density of States in Intentionally
• Igor P. Zvyagin

... Online Services | ... Construct your query and output by sequental openings of needed fields. One output field must be selected (not be blank) at least. ... Query parameters: . Select for output . ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ... Excited energy(keV) . ...

Еще в разделе: (Показать все результаты (>54) - cdfe.sinp.msu.ru/ )

• Index of /services/wftables
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => Nucleus Ground State Parameters

... Магистерское образование . ... Магистерские программы . ... Магистерские программы (учебные планы) . ... Introduction to Cryptography . ... Basic requirements for data security in software systems. ... Lecturer: associate professor Primenko E. A. Mathematical Theory of Information . ... Addition operation of elliptic curve's points. f Postnikov's theorem.Theorems on the order of elliptic curve for certain types of primes. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>12) - hcs.cmc.msu.ru/ )

• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>264) - www.geogr.msu.ru/ )

• CONTENTS ?3 - 2009
• CONTENTS ? 4 - 2013
• CONTENT 1 (4) 2011

Bc J / (Bs , Bs ) + n Decays A. Berezhnoy , A. Likhoded, A. Luchinsky 27.09.2011 A. Berezhnoy , A. Likho ded , A. Luchinsky Bc J / (Bs , Bs ) + n Decays Aims of research To estimate the branching ratios for the decays Bc J / (Bs , Bs ) + n To develop the package for simulation these decays within standard LHCb software GAUSS A. Berezhnoy , A. Likho ded , A. Luchinsky Bc J / (Bs , Bs ) + n ... R ё Aµ = J / c µ 5 b Bc = Ї b c Bc c J / Figure: Diagram for Bc J / + n decay. ...

Еще в разделе: (Показать все результаты (>138) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf
• http://qfthep.sinp.msu.ru/talks/GRACE.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435513529_malyshev_Higgs.pdf

... We present some results of new calculations of D" ( t ) the second derivative of the Moon's elongation as a function of time. ... Let X be a set of all preserved recordings of observations of ancient Sun and Moon eclipses (see the list in [ 2 ], pp. 167 271): let A be a set of eclipses described in X (any eclipse a A may have some records corresponding to it and form X ( a )). ... The recount of dates t ( a 0 ), a 0 A ,( 700) < t ( a 0 ) < (+400), was first made by N. A. Morosov. ...

Еще в разделе: (Показать все результаты (>95) - hbar.phys.msu.ru/ )

• newtrev2.htm
• Ответ Wally на книгу "Крах С14"

... О кафедре . ... Сотрудники . ... Соколов Дмитрий Дмитриевич, родился в 1949 г., поступил на Физфак МГУ в 1966 г., с 1972 г. - на кафедре математики, сначала аспирант, а потом, постепенно, стал профессором, доктором физ.-мат. наук. ... Magnetic fields as a unique tracer of shearing gas flow in a barred galaxy", Beck R., Ehle M., Shoutenkov V., Shukurov A., Sokoloff D., Nature, 397, (1999), 324. ... Семинар кафедры . ... Кафедра математики физического факультета МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>3) - matematika.phys.msu.ru/ )