... Inorganic Synthesis . ... The course consists of the general laws of chemistry (principles of chemical thermodynamics, kinetics, solution theory, theory of chemical bond, structure of molecules), chemistry of elements (structure and properties of simple substances and mains of inorganic compounds, relationships of properties changes on the base of Periodic Law), reactions and methods of quality analysis. ... SPECIAL COURSE: PHYSICAL AND CHEMICAL BASES OF SOLID STATE SYNTHESIS OF INORGANIC MATERIALS ...

Еще в разделе: (Показать все результаты (>53) - www.inorg.chem.msu.ru/ )

• I n o r g a n i c C h e m i s
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds
• Inorganic Synthesis Laboratory

... The factors that play the key role in complex formation are as follows: the rate of protein diffusion to the docking site; long-range electrostatic interactions between protein surfaces, geometric and chemical complementarity of binding areas; molecular mobility at the protein­protein interphase, hydrogen bonds, Van der Waals interactions, hydrophobic interactions, and salt bridges. ... Three-dimensional protein molecules are constructed on the basis of data extracted from the Protein Data Bank. ...

Еще в разделе: (Показать все результаты (>32) - www.library.biophys.msu.ru/ )

• MECHANISMS OF THE ACTION OF A LOW-FREQUENCY MAGNETIC FIELD ON THE INITIAL

Towards celestial sources above 1 THz with a heterodyne receiver based on a hot-electron bolometer mixer Sergey Ryabchun, Ivan Tretyakov, Matvey Finkel, Natalia Kaurova, Boris Voronov and Gregory Gol'tsman HOT-ELECTRON BOLOMETER (HEB) MIXER Scient ific and Educatio nal Radiophysics Center Mo scow State Pedago gical University Mo scow, Russia FIRST GROUND-BASED OBSERVATION WITH HEB MIXERS BEYOND 1 THz Submillimeter Telescope ...

Еще в разделе: (Показать все результаты (>19) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/Site2010-Summary.pdf
• http://site2010.sai.msu.ru/static/doc/VNosov_site2010.pdf

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

... education . research . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... Pass/fall exam: 5 p.m., 22 May, 2009 (those third-year students who pass the exam undertake further study majoring in Nanosystems and Nanodevices , Functional Nanomaterials , Nanobiomaterials and Nanobiotechnology). ... 10 February 2009 . ... Prof. Yu. ... Work of molecular motors: ATP synthetase, photosynthetic reaction centers, retinal containing photosensitive proteins (rhodopsin, bacteriorhodopsin.) ...

Еще в разделе: (Показать все результаты (>18) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по

2 (a) (b) (c) (d) Functions determine the image determine whether a find the inverse of a find the composite of of a given function; given function is one-one and/or onto ; given one-one function; two given functions. ... In the previous unit we concentrated on real functions--that is, functions whose domains and codomains are subsets of R. You can think of these functions as machines for processing real numbers. ... x This function is not one-one and so does not have an inverse function. ...

Еще в разделе: (Показать все результаты (>21) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/theses3.pdf
• http://www.eng.math.msu.su/download/section_1.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>8) - lhe.sinp.msu.ru/ )

... Магистерское образование . ... Магистерские программы . ... Магистерские программы (учебные планы) . ... Introduction to Cryptography . ... Basic requirements for data security in software systems. ... Lecturer: associate professor Primenko E. A. Mathematical Theory of Information . ... Addition operation of elliptic curve's points. f Postnikov's theorem.Theorems on the order of elliptic curve for certain types of primes. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>18) - hcs.cmc.msu.ru/ )

• Master program "Mathematical and computer methods of image processing" |
• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ­ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./leigh.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>167) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• Inquiry information || Distances
• Homeobox_main

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>211) - observ.pereplet.ru/ )

... QUANTUM INFORMATION AND COMPUTATION Absolute Robustness of the First Principal Fourier State Component and Noise Suppression in Hilbert Space Yu. ... 2, Moscow, 119992 Russia e-mail: skulik@qopt.phys.msu.su Received March 28, 2006 Abstract--The effect of the absolute robustness of the first principal Fourier-state component is developed upon rounding off the density matrix elements. ... This is interpreted as the absolute robustness of the first principal component of the Fourier state density...

Еще в разделе: (Показать все результаты (>135) - qi.phys.msu.ru/ )

• Publications :: Quantum Information Laboratory
• Directions :: Quantum Information Laboratory

... Форумы > Аспирантура > Тема . ... Форумы Список тем Новая тема . ... Аспирантура ин-т Макса Планка / ун-т Заарланда, Германия . ... http://flake.cs.uiuc.edu/~titov/ . ... http://www.mmci.uni-saarland.de/ . ... http://cs.uni-sb.de/ . ... http://www.mpi-inf.mpg.de/ . ... http://www.dfki.de . ... http://www.mpi-sws.org . ... http://www.coli.uni-saarland.de/ . ... http://www.saarbruecken.de/en/home . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>91) - www.mmonline.ru/ )

• Математический семинар Глобус, заседание 12 октября 2006 г.
• Заседание Московского Математического Общества 26 октября
• MMOnline | Форумы | Аспирантура | PhD position at the University of Geneva,

... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions · cudaMalloc() ­ Allocates object in the device global memory ­ Two parameters · Address of a pointer to the allocated object · Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers · cudaFree() ­ Frees object from ...

Еще в разделе: (Показать все результаты (>5) - ccoe.msu.ru/ )

... Printed in the UK PII: S0022-3727(00)13723-4 Surface segregation of transition metals in sol ­gel silica films V B Prokopenko, V S Gurin§, A A Alexeenko , V S Kulikauskas and D L Kovalenko Advanced Materials Laboratory, Gomel State University Silica sol­gel films (SGFs) doped with various transition metals derived by spin-coating on glass substrates and silicon wafers have been studied. ... Remarkable segregation of metals at the surface was observed for films doped with Cu and Co. ...

Еще в разделе: (Показать все результаты (>107) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/ACS_pdf/atcol_1.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_830_GCIB_Applications_Equipment.pdf
• http://danp.sinp.msu.ru/LINT/NIMB270_2012_P50.pdf

Клуб выпускников МГУ (Московский Государственный Университет) . ... Bahamas resident Peter Nygard says he is receiving stem cell therapy and that a study from the University of Miami suggests he is getting younger, the Bahamas Tribune reports. ... The great man in question is none other than Peter Nyg?rd, the Helsinki-born, Manitoba-raised fashion magnate best known as the founder of Nyg?rd International. ... That alone is fascinating, but Nyg?rd isn't just a stem-cell advocate. ...

Еще в разделе: (Показать все результаты (>245) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Конкурс российско-голландских проектов 2005 года.
• Клуб выпускников МГУ: Ученые: молодая кровь - путь к продлению жизни и
• Клуб выпускников МГУ: Лекарство, реально помогающее при болезни Альцгеймера,

Mueller polarimetry as a tool for detecting asymmetry in diffraction grating profiles Tatiana Novikovaa) and Pavel Bulkin LPICM, CNRS, Ecole Polytechnique, Palaiseau 91128, France b) Vladimir Popov Skobeltsyn ... Ecole Polytechnique, Palaiseau 91128, France (Received 19 March 2011; accepted 19 July 2011; published 9 September 2011) Reflected Mueller matrix spectra were measured and simulated for asymmetrical photoresist master diffraction ... Parametric model of grating profile. ...

Еще в разделе: (Показать все результаты (>25) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/sci/photonics/PDF/4(en).pdf

JOURNAL OF STRUCTURAL BIOLOGY 113, 217-224 (1994) Centrosome Behavior under the Action of a Mitochondrial Uncoupler and the Effect of Disruption of Cytoskeleton Elements on the Uncoupler-lnduced ... 119899, Russia Received October 3, 1994, and in revised form February 6, 1995 Carbonyl cyanide p-(trifluoromethoxy)phenylhydrazone ( FCCP ) induced in pig kidney embryo cells a loss of rhodamine 123 staining of mitochondria in 2-3 min ... In 3 cells, the active centriole possessed three satellites. ...

Еще в разделе: (Показать все результаты (>36) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/vorobjev83.pdf
• http://cellmotility.genebee.msu.ru/html/articles/uzbekov96.pdf