Experimentation and Personality , 1 Explicating the Black Box through Experimentation : Studies of Individual Differences and Cognitive Processes Howard Lavine Department of Political Science, SUNY ­ Stony Brook Stony Brook, NY 11794-4392 Howard.Lavine@sunysb.edu Corresponding Author Milton Lodge Department of Political Science, SUNY ­ Stony Brook Stony Brook, NY 11794-4392 Milton.Lodge@sunysb.edu James Polichak School of Law, University of Michigan ... The Authoritarian Personality. ...

Еще в разделе: (Показать все результаты (>22) - suny.msu.ru/ )

• http://www.suny.msu.ru/en/CyberCon05En.doc
• http://suny.msu.ru/ru/ProgramMaBIT05En.doc

European Research Council IDEAS Coordination and Support Action (CSA) Call identifier: ERC -2009-SUPPORT Guide for Applicants Version: 16 July 2008 The Guide is published by the ERC -DIS on http:// erc .europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu European Commission FP7 Specific Programme IDEAS ... Consequently, the ERC needs to be rigorous in evaluating the very best science and researchers and in selecting innovative and "high risk/high gain" projects. ...

Еще в разделе: (Показать все результаты (>37) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/ERC_rules.pdf
• http://ideas.msu.ru/docs/call_StG_2012.pdf
• http://ideas.msu.ru/docs/Work_programme_2011.pdf

... New Properties of Sound Waves in Nonequilibrium Media with the Negative Second Viscosity . ... In a wide class of nonequilibrium media (e.g. nonisothermal plasmas, chemical and optical active gases, reactors, atmospheric condensation) the second (bulk) viscosity coefficient can become negative due to positive feedback between the sound disturbance and the nonequilibrium heating [1]. ...

Еще в разделе: (Показать все результаты (>170) - acs366.phys.msu.su/ )

• Abstract (Invited)

... О Школе . ... Магистерская программа Высшей школы бизнеса МГУ получила международную аккредитацию ABEST21 . ... В 2015 году Высшая школа бизнеса МГУ подтвердила статус одной из ста лучших бизнес-школ мира и получила награду высшей категории как 'бизнес-школа, имеющая наивысшее международное влияние'. 21.10.2015 . ... Декан Высшей школы бизнеса МГУ О.С. Виханский получил награду от Международной ассоциации бизнес-образования ABEST21 за 10-летний вклад в работу ассоциации в качестве ее Вице-президента...

Еще в разделе: (Показать все результаты (>4430) - www.mgubs.ru/ )

Series on Stability, Vibration and Control of Systems, Series A - Vol. ... MULTIPARAMETER STABILITY THEORY WITH MECHANICAL APPLICATIONS . ... This book deals with fundamental problems, concepts, and methods of multiparameter stability theory with applications in mechanics. ... Introduction to Stability Theory . ... Read Full Review . ... Since Bolotin's pioneering book on nonconservation problems on the theory of elastic stability, not many books appeared at such a high level, such as this one. ...

Еще в разделе: (Показать все результаты (>31) - mailybaev.imec.msu.ru/ )

• Book review by Professor Alois Steindl

... In Chap. ... sign cos : By the theorem on the motion of the center of masses in the space in projections to the related axes .x ; y ; z/ and the theorem on the change of the kinematic moment with respect to these axes, we obtain the following complete system of differential equations in the dynamical quasi-velocity space R1 fvg S2 f; g C R3 fx ;y ;z g: v cos P v sin C y v sin sin P 2 2 z v sin cos C .y C z / D Fx =m; v sin cos C v cos ... I2 n0 d cos with variable coefficient....

Еще в разделе: (Показать все результаты (>37) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-156-1.pdf
• http://shamolin2.imec.msu.ru/art-185-2.pdf
• http://shamolin2.imec.msu.ru/art-102.pdf

Psychology in Russia: State of the Art · 2009 From reFlec tory ring to multivariable system natoly I. Nazarov Dubna International University of Nature, Society, and Man Dubna Some special features of feedback functioning in live movement control are discussed. ... The main role here play human perception of the information resulted from movement performance on the level of motor-sensory transition, when multidimensional vector of muscle dynamics transforms into dynamics of outer object environment. ...

Еще в разделе: (Показать все результаты (>153) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2013-2/bazarov_2013_2.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/leonova.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/ismagilova.pdf

... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>10) - iconolat13.phys.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Terrestrial ecosystems . Research . ... Environmental pollution and protection in the Norwegian-Russian border area are the main themes of research cooperation between the Soil Science Faculty of Moscow State University (MSU) and the Norwegian Forest Research Institute (NISK). ... The bilateral scientific cooperation between Norway and Russia was established in 1988, based on joint governmental agreement on environmental problems. ... Norwegian Forest Research Institute, Norway . ...

Еще в разделе: (Показать все результаты (>23) - eco.soil.msu.ru/ )

... 281 The Dating of Ptolemy's Almagest Based on the Coverings of the Stars and on Lunar Eclipses A. T. FOMENKO Department of Geometry and Topology, Faculty of Mathematics and Mechanics, Moscow State University, 119899, Moscow. ... Dating, latitude, longitude, star coverings, lunar eclipses. ... The Dating of the Lunar Eclipses The 21 lunar eclipses mentioned in the Almagest were observed by different astronomers approximately during the time interval from 26 till 881 years of Nabonassar. ...

Еще в разделе: (Показать все результаты (>85) - hbar.phys.msu.ru/ )

• R. R. Newton, "Two uses of ancient astronomy"
• JulDate.htm
• The Work of Velikovsky

Eugene Babaev "Intuitive Chemical Topology Concepts" (c) 3. ... The above set of visual topology concepts may enable us to check whether the terms "molecular graphs" and "molecular surfaces" are well-defined from the topological viewpoint. ... Molecular surface. ... Nevertheless, it is possible to reconstruct the familiar concepts of a molecular graph and a molecular surface from the quantum-chemical model, although each time we need such a graph or a surface, some calculations should be carried out. ...

Еще в разделе: (Показать все результаты (>135) - www.chem.msu.ru/ )

• THE ALTERNATION RULE: AN OLD HEURISTIC PRINCIPLE OR A NEW CONSERVATION LAW

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... Вакансии . ... Commitment: the dedication to achieve your goals - and to continuous professional and personal development . ... HP Graduate Development Program: Our new 18 month Graduate Development Program has been designed to get the most out of the best graduates by giving you the opportunity to gain experience and exposure across HP's businesses. ... HP gives you the opportunity to transition from a brand new graduate to a professional in Sales, Information Technology, Consulting and Marketing. ...

Еще в разделе: (Показать все результаты (>98) - www.physcareer.ru/ )

• Intern in Risk Assurance department, компания PwC / Стажировки / Physcareer.ru
• Quality Control Engineer / Tester (Student/Intern) / Вакансии / Physcareer.ru
• HR manager, P Human Resources , компания Procter / Вакансии / Physcareer.ru

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/pmt_param_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/sv_ug.pdf
• http://curl.sai.msu.ru/mass/download/doc/res2007eng.pdf

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . ... Select Type . ... Ref . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Config.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1
• http://osk.msu.ru/forum/members/catyfopwbex.2168/?_debug=1

... Our faculties perform research within the frame of more than 80 collaborative agreements with the universities and scientific centers worldwide, actively participate in various international projects under umbrella of the Russian and international funding agencies. ... F irst, we are interested in collaboration with those research centers and universities worldwide who offer research opportunities complimentary to ours. ... Germany . ... Institute or Nuclear Physics, National Nuclear Centre . ...

Еще в разделе: (Показать все результаты (>40) - foroff.phys.msu.ru/ )

• Глубокоуважаемые коллеги

Tools for monitoring of data exchange in real-time avionics systems V.V. Balashov, V.A. Balakhanov, A.G. Bakhmurov, M.V. Chistolinov, P.E. Shestov, R.L. Smeliansky, N.V. Youshchenko Lomonosov Moscow State University, Dept. of Computational Mathematics and Cybernetics, Laboratory of Computer Systems e-mail: {hbd,baldis,bahmurov,mike,osmin,smel,yoush}@lvk.cs.msu.su Abstract In this paper we present a toolset for monitoring of data exchange through onboard channels of real-time avionics (RTA) systems. ...

Еще в разделе: (Показать все результаты (>9) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_advanced_networks/ITU_OTN_Tutorial.pdf
• http://lvk.cs.msu.su/~sveta/4-2wireshark.pdf

... Полная версия этой страницы: UFO Events and Cases . Студенческий форум Физфака МГУ > Физфак и учеба > Форумы групп > 219 группа 2007 года рождения . ... According to the NASA Astronaut Neil Armstrong the Aliens have a base on the Moon and told us in no uncertain terms to get off and stay off the Moon! ... According to hitherto unconfirmed reports, both Neil Armstrong and Edwin "Buzz" Aldrin saw UFOs shortly after that historic landing on the Moon in Apollo 11 on 21 July 1969. ... Apollo 11: . ...

Еще в разделе: (Показать все результаты (>965) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > EURO 2008
• Студенческий форум Физфака МГУ > Работа в Samsung
• Студенческий форум Физфака МГУ > Каррент мьюзик