# # ChangeLog for / # # Generated by Trac 0.12.5 # 04/12/16 00:00:17 Sun, 19 Dec 2010 21:45:40 GMT Alex Martynov [72:abd610462b02] merge Sun, 19 Dec 2010 21:45:24 GMT Alex Martynov [71:198e91c5b94c] * engine.py (modified) some errors fixed Sun, 19 Dec 2010 21:43:36 GMT Danya Alexeyevsky <me.dendik@тАж> [70:e8eabd9530a1] * snake.py (modified) snake.Rule.load returns self for convenience

Еще в разделе: (Показать все результаты (>624) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=72%3Aabd610462b02&stop_rev=70%3Ae8eabd9530a1&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=abd610462b025cc2170d03a0052d273878b9c11a&stop_rev=70%3Ae8eabd9530a1&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=101%3A0865e29e319d&stop_rev=99%3A33fea6b97cd3&limit=100&mode=stop_on_copy

Dmitri Lukjanchikov - MSU78 slugger, who also takes a job of our coach. Usually he is a stretching and power lifting coach in the winter, but he coaches also in spring-summer-autumn. He makes on us a lot of running, stretching and throwing drills. About his playing career: He played for SKA MVS in 1997 and returned to the MSU78 in 1998. He is the best power hitter in MSU78 lineup, but he bats fifth. ... Here is Dmitri' 1997 and 1998 statistics . ... 1997 . SKA MVS .314 . ... 1998 . ...

Еще в разделе: (Показать все результаты (>4) - mguteam.chat.ru/ )

• http://mguteam.chat.ru/josh1.html

Джоан Ролинг . ... Harry Potter and the Half-Blood Prince takes up the story of Harry Potter's sixth year at Hogwarts School of Witchcraft and Wizardry at this point in the midst of the storm of this battle of good and evil. ... And most importantly, the opening chapter of Harry Potter and the Half-Blood Prince has been brewing in J.K. Rowling's mind for 13 years. книга " Harry Potter and the Half-Blood Prince. Book 6 / Гарри Поттер и Принц Полукровка. Книга 6 " . ...

Еще в разделе: (Показать все результаты (>37) - www.chemport.ru/ )

... Site is discontinually updating by professional biologists and students of biology faculty of MSU. ... Journals began from 'L' . The search returns the following error: . No journals match your request. Try to redo the search with softer conditions. JCatalog | Journal list . All information on this site is official. ... Belozersky's Institute of Physico-Chemical Biology . ...

Еще в разделе: (Показать все результаты (>9) - journals.genebee.msu.ru/ )

... Аннотированный каталог . ... Обмен ссылками . ... a target=_top href="http://abiturcenter.ru"> <img width="88" height="31" alt="Учебно-научный центр довузовского образования" src="http://abiturcenter.ru/images/unc2.gif" border="0"></a> . a target=_top href="http://abiturcenter.ru/izdat/"> <img width="88" height="31" alt="Издательство УНЦ ДО" src="http://abiturcenter.ru/izdat/izdat.gif" border="0"></a> . ... document.write ("<" + "script language='JavaScript' type='text/javascript' src='"); . ...

Еще в разделе: (Показать все результаты (>2) - www.abiturcenter.ru/ )

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>9) - www.sciencepark.ru/ )

• MSU Science Park - Venue & Space

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>11) - astrometric.sai.msu.ru/ )

• Specification
• Symbolic matrix processor
• Complex evaluator

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>6) - physcontrol.phys.msu.ru/ )

• List All Categories

Protein 3D architectures and structural motifs: automated annotation E.A. Aksianov1, A.V. Alexeevski 1 2 1,2 Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia evaksianov@gmail.com, aba@belozersky.msu.ru Description of a protein 3D structure in terms of structural domains, architecture, topology and structural motifs is a hard problem. ... The core is extended by small -sheet (unit_3). ...

Еще в разделе: (Показать все результаты (>142) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/162.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/12.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/51.pdf

... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! ... 28.05.2004 . New full on-line Russian language reference on our website! (more.. ... On April, 29, 2004 the rector of the Moscow M.V.Lomonosov State University academician V.A.Sadovnichy signed the order on creation of the Moscow school of economy of the Moscow M.V.Lomonosov State University. (more.. ... Space tourist calls Russian language his greatest challenge . ...

Еще в разделе: (Показать все результаты (>8) - www.rlcentre.com/ )

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• RNA kinetics server
• SDPsite - Gallery of examples
• Alignment example

... 17, No. 10 (2007) 3603ґ3606 c World Scientific Publishing Company STABILIZATION OF CHAOTIC BEHAVIOR IN THE RESTRICTED THREE-BODY PROBLEM ARSEN DZHANOEV and ALEXANDER LOSKUTOV Physics Department, Moscow State University, Leninskie Gory, Moscow 119992, Russia janoev@pol ly.phys.msu.ru Loskutov@chaos.phys.msu.ru Received Octob er 19, 2005; Revised February 20, 2006 The restricted three-bo dy problem on the example of a perturbed Sitnikov case is considered. ... The Sitnikov problem. ... Fig. ...

Еще в разделе: (Показать все результаты (>64) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/PLoS_One_2009.pdf

Intel Thread Checker 2- pozdneev@gmail.com . Intel Thread Checker 14 2008 1 / 26 1 Intel Thread Checker 1: Intel Thread Checker 2: Intel Thread Checker 14 2008 2 / 26 2 3 4 5 6 7 ( ) Microsoft Windows Intel Thread Checker / ?? (Intel Software Development Tools Intel(R) Thread Checker x.x) icl ( Intel Software Development Tools Intel C++ Compiler xx.x.xxx C++ Build Environment for applications running on . ... 1 |Write -> |Err|4|omp|Memory read of glb_primes_found at |"prim|"prim| ... Read |or | ...

Еще в разделе: (Показать все результаты (>5) - angel.cmc.msu.ru/ )

• http://angel.cmc.msu.ru/~ifed/teraflops/Popova_MPI.pdf
• Index of /~basrav/supercomp2010

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>22) - ecology.genebee.msu.ru/ )

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>281) - higeom.math.msu.su/ )

• C*-algebras and elliptic theory
• C*-algebras: Talks

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>11) - www.ied.msu.ru/ )

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>48) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>1706) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Theoretical PhD studies
• Студенческий форум Физфака МГУ > Theoretical PhD studies, PhD positions for

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... 2 Ї ґ , , Ї ґ Ї ґ , 03.12.2015 . ... 14 03.12.2015 Ї Ї Ї 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>10) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~sveta/4-3sw.pdf