... Кадровый состав . Обучение на кафедре . ... Введение в квантовую физику . FAQ для студентов . Информация о курсовых 2 курса . О кафедре . ... 23 / декабря 2013 . В понедельник, 23 декабря 2013 г. в 10-00 в конференц-зале КНО состоятся защиты дипломных работ студентов кафедры. 16 / декабря 2013 . В понедельник, 16-го декабря, в конференц-зале КНО состоится очередное, 734-е, заседание научного семинара кафедры квантовой электроники. ... 2003 2016 Кафедра квантовой электроники . ...

Еще в разделе: (Показать все результаты (>9) - quantum.phys.msu.ru/ )

• Лаборатории | Кафедра квантовой электроники

The Department of Talented Youth Affairs and Professional Orientation . ... Older posts . Posted on 09.11.2015 by admin . ... The team competitions Continue reading . Posted in News , Без рубрики | Leave a comment . ... In the 2015/16 Continue reading . ... The festival is organized by the Department of Continue reading . ... Posted on 17.11.2014 by admin . ... Federal Agency for Youth Affairs ?Rosmolodezh?, ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>32) - talant.msu.ru/ )

• The Fourth Online Festival of Friendship | The Department of Talented Youth
• All-army olimpiad | The Department of Talented Youth Affairs and Professional
• News | The Department of Talented Youth Affairs and Professional Orientation |

Кафедра общей физики . физфака МГУ . ... О кафедре . ... Контакты . Кафедра общей физики - школе . ... Кафедры . ... МГУ . ... Предметом исследований являются фундаментальные нелинейно-волновые процессы, происходящие при взаимодействии высокоинтенсивного оптического излучения с веществом. ... Для исследования привлекаются современные методы математической физики, широко используется компьютерное моделирование. ...

Еще в разделе: (Показать все результаты (>130) - genphys.phys.msu.su/ )

• Index of /mikromag/main/conf
• Научные направления
• Микромаг - сервер

Lomonosov Moscow State University , Skobeltsyn Institute of Nuclear Physics , . Online Services . ... The Centre for Photonuclear Experiments Data (Centr Dannykh Fotoyadernykh Eksperimentov - CDFE) of the Moscow Lomonosov State University Skobeltsyn Institute of Nuclear Physics is the member of the Nuclear Reaction Data Centres Network (NRDCNW) , a world-wide cooperation of nuclear data centres from various countries under the auspices of the International Atomic Energy Agency (IAEA). ...

Еще в разделе: (Показать все результаты (>11) - cdfe.sinp.msu.ru/ )

• CDFE Activities

... МУЛЬТИСТАЦИОНАРНЫЕ СИСТЕМЫ . ... На рис. 7.1 представлен относительно простой фазовый портрет триггерной системы, описывающей явление конкуренции двух одинаковых видов: . Рис. ... Соответствующая система уравнений имеет вид: . ... Такая система имеет четыре стационарных решения: . ... Исследование системы (7.19) показало, что при m = 0 фазовый портрет имеет одну устойчивую особую точку в первом квадранте фазовой плоскости (рис. 7.10 а ) и не может описывать процессов переключения в системе. ...

Еще в разделе: (Показать все результаты (>39) - www.library.biophys.msu.ru/ )

... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...

Еще в разделе: (Показать все результаты (>4) - rnp-group.genebee.msu.ru/ )

Call Title: Call for proposals for ERC Starting Independent Researcher Grant Call identifier: ERC -2012-StG Date of publication: 20 July 2011 Electronic proposal submission deadlines1 (single submission of full proposal): 2 Domain Physical Sciences Engineering (Panels PE1 - PE10): 12 October 2011, 17.00.00 (Brussels local time) Domain Life Sciences (Panels LS1 ­ LS9): 9 November 2011 17.00.00 (Brussels local time) Domain Social ... See section 4.6 and Annex 9 of the work programme. ...

Еще в разделе: (Показать все результаты (>31) - ideas.msu.ru/ )

• http://ideas.msu.ru/news/19_10_2010/Press_release.pdf
• http://ideas.msu.ru/docs/call_SyG_2012.pdf
• http://ideas.msu.ru/docs/AdG_call_2010.pdf

... Letter of Application . ... Minilecture: How to organise information in the letter of application. When one applies for a position in a company, the letter of application cannot and should not contain all the information a prospective employer wants to know about you. ... If you know about a job opening within the company, refer directly to that position; if some person from that company told you of the job opening, you may begin the first paragraph by mentioning this person by name. ...

Еще в разделе: (Показать все результаты (>13) - anazarenko.ffl.msu.ru/ )

• Тестирование по английскому языку

... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Second order Tikhonov regularization method for image filtering . Publication type . Conference paper . ... Publication date . 2006 . Conference . 16th International Conference Graphicon'2006 . ... Title = {Second order Tikhonov regularization method for image filtering}, . ... BookTitle = {16th International Conference Graphicon'2006}, . Year = {2006}, . ...

Еще в разделе: (Показать все результаты (>61) - imaging.cmc.msu.ru/ )

... This article concerns with the research of island flora. ... The islands under investigation are subdivided in 8 archipelagos, which are situated in Chupa Gulf and Kiv Gulf . ... The following parameters were recorded for each island: an abundance of species, a distance to the continent, a relief, an openness, a frequency of finding the different biotopes, any traces of people's activity, the type of island according to the classification from Breslina work (Breslina, 1987). ...

Еще в разделе: (Показать все результаты (>224) - herba.msu.ru/ )

• Cladocera in rock pools of White sea islands: fauna dynamic during three years
• поведение устьиц литоральных растений
• Algae as indicators of enviromental quality

... Кафедра фотоники и физики микроволн физического факультета МГУ имени М.В. организует XV Всероссийскую школу-семинар ?Волновые явления в неоднородных средах? имени А.П. (?Волны-2016?) Школа-семинар будет проходить с 5 10 2016 года на Физическом факультете МГУ и в Доме отдыха ?Красновидово?, расположенном в живописном месте Подмосковья на берегу Можайского водохранилища вблизи Можайска. ... академик, ИПФ РАН (заместитель председателя) . ... академик, ИПФ РАН . ... академик, МГУ и ИПЛИТ РАН . ...

Еще в разделе: (Показать все результаты (>3) - waves.phys.msu.ru/ )

Software Protection: How to Crack Programs, and Defend Against Cracking" In the first part of this course we will learn how to "crack" programs, i.e.how hackers break into software to extract secrets, remove license checks, etc. ... Learning about this type of computer security is important because many current systems are vulnerable to cracking attacks. ... The course will have practical homework exercises where you will crack small programs, and use tools to protect against cracking. ...

Еще в разделе: (Показать все результаты (>2) - master.cmc.msu.ru/ )

A program for automatic detection of aligned blocks in multiple protein alignment. Paste your alignment in fasta-format here: . ... The program works slow - it takes 8 seconds to process alignment of 6 sequences of length 500. The program's development is supported by Russian Foundation for Basic Research (grant 10-07-00685-a) and Ministry of Education and Science of the Russian Federation (State Contract No. 07.514.11.4006). ...

Еще в разделе: (Показать все результаты (>7) - mouse.belozersky.msu.ru/ )

• wLake algorithm description

... 07.04.2016 (Thursday) Session 1 10:00-10:20 10:20-10:40 10:40-11:00 11:00-11:20 11:20-11:40 ­ ­ ­ ­ ­ (chairman ­ M. Stynes) N. Kopteva V. Andreev H.-G. Roos S. Franz, H.-G. Roos A posteriori error estimates for singularly perturbed reactiondiffusion problems on anisotropic meshes. ... Numerical solution of a singularly perturbed initial-boundary value problem with a Neumann condition for a parabolic equation. ... Boundary layer solutions to time-periodic singularly perturbed parabolic problems. ...

Еще в разделе: (Показать все результаты (>2) - math.phys.msu.ru/ )

Bc J / (Bs , Bs ) + n Decays A. Berezhnoy , A. Likhoded, A. Luchinsky 27.09.2011 A. Berezhnoy , A. Likho ded , A. Luchinsky Bc J / (Bs , Bs ) + n Decays Aims of research To estimate the branching ratios for the decays Bc J / (Bs , Bs ) + n To develop the package for simulation these decays within standard LHCb software GAUSS A. Berezhnoy , A. Likho ded , A. Luchinsky Bc J / (Bs , Bs ) + n ... R ё Aµ = J / c µ 5 b Bc = Ї b c Bc c J / Figure: Diagram for Bc J / + n decay. ...

Еще в разделе: (Показать все результаты (>91) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2015/QFTHEP_Fedorov_N_MSU.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP-2010_-_Sukachev.pdf
• http://qfthep.sinp.msu.ru/talks/pr_Gamzova.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>104) - www.genebee.msu.ru/ )

• Picornaviruses: discovering big in small
• IGLA-3D User Guide
• AliComp - GeneBee Alignments Comparison - Advanced

MSU . Science Park . ... Science Park was established in 1990 by the Academic Board of Moscow State University. MSU Science Park provides search services for locating partners, finance and employees for innovation projects. ... The MSU Science Park Mission is to stimulate innovation within the university with activities designed to bring about structural changes in Moscow?s economy. ... University, Technopark Skolkovo Technopark Strogino and Innovation Development Center in Moscow. ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )

• MSU Science Park - News

Проект Ломоносов . ... М.В. Ломоносов . ... Это будет более крупным космическим проектом МГУ по сравнению с предыдущими спутниками ?Татьяна? и ?Татьяна-2?. ... МГУ носит имя М.В.Ломоносова . Поэтому имя М.В.Ломоносова ?на борту? спутника ? ... Зарисовка из книги М.В. Ломоносова. Запуск спутника ?Михайло Ломоносов? безусловно внесет значительный вклад в развитие человеческого знания в область физики, исследования которые начал еще М.В. Ломоносов (исследования природы молний и т.д.). ...

Еще в разделе: (Показать все результаты (>36) - lomonosov.sinp.msu.ru/ )

• Научные задачи | Университетский спутник "Ломоносов"
• Gamma-bursts | Университетский спутник "Ломоносов"
• BDRG | Университетский спутник "Ломоносов"

Воропаева Галина Антоновна - поэт. ... Закончила физфак МГУ (1970). ... Далее вышли еще 5 сборников: "Контур смысла" (1997), "Second" (1998), "Реактивный тепловоз" (1999), "Все равно разговор будет длиться и длиться" (2000), "Портрет героя (карандаш)" (2001). ... С 2000 г. работает в НИВЦ МГУ. ... Жизнь бывает похожа на пошлый лубок.. ... 1998 . ... Сидит на пеньке невеликий поэт, . ... От птицы колеблется ветка. ... 1999 . ... Впрочем, бывает везенье, . ... 2001 . ... Птица дивная, не разорвись! ...

Еще в разделе: (Показать все результаты (>153) - getmedia.msu.ru/ )

• Поэты МГУ - Виноградова (Логачева) Татьяна Евгеньевна

... Platonov a, A.F. Tulinov a, O.A. Yuminov a,* b D.V. Skobeltsyn Institute of Nuclear Physics, M.V. Lomonosov Moscow State University, Vorobyevy gory, Moscow 119992, Russia Instituto Nazionale di Fisica Nucleare, Sezione ... Dipartimento di Fisica della Universita, Bologna, Italy a Abstract The crystal blocking technique has been used to measure the induced fission lifetimes for the 232 ;233 Pa and 232 U nuclei produced in the 232 Th Ч p and ... For the 232 ThПp; xnf ч Fig. ...

Еще в разделе: (Показать все результаты (>77) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf
• http://danp.sinp.msu.ru/Tulinov_85/NIMB267(2009)2592-AFT.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_855_Yamada_B-ClasterIons.pdf