Аномалии полового развития амфипод Gammarus pulex (L.), найденных ниже станции для очистки сточных вод. ... С. 1792-1797. ... У самцов амфипод, обитающих ниже очистных сооружений в графстве Суррей (Великобритания), строение гонад, наружные половые признаки и размеры тела были такими же, как на контрольном участке. У самок значительно нарушалась структура ооцитов в вителлоегенезе. Одновременно уменьшалась длина тела самок и отношения размера самцов к размеру самок по сравнению с контролем. ...

Еще в разделе: (Показать все результаты (>4) - ecoinformatica.srcc.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>195) - kodomo.fbb.msu.ru/ )

Proteogenomic analysis of bacterial signal peptides Dmitry N. Ivankov1, Samuel H. Payne2, Stefano Bonissone3, Si Wu4, Roslyn N. Brown2, Ljiljana Pasa-Toli4, Matthias Birschenk5, Iris ... Department of Genome-Oriented Bioinformatics, Technische UniversitДt MЭnchen, Freising, Biological Sciences Division, Pacific Northwest National Laboratory, Richland, WA, USA ; Bioinformatics Program, University of California San Diego, La Jolla, CA, ... 2013) How many signal peptides are there in bacteria? ...

Еще в разделе: (Показать все результаты (>51) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/4.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/120.pdf

Moscow 2013 16th Lomonosov Conference Particle Accretion onto Miniholes Michael L. Fil'chenkov Yuri P. Laptev Institute of Gravitation and Cosmology, Peoples' Friendship University of Russia, Moscow 1 Moscow 2013 16th Lomonosov Conference Outline · Introduction · Classical Accretion onto Black Holes · Quantum Hydrodynamics · Quantum Accretion on The total luminosity of the accretion disc and the energy of quanta being emitted have been calculated. ...

Еще в разделе: (Показать все результаты (>18) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Fil'chenkov.pdf

... Add the jqWikiWord to an html input field and specify the source from which to derive the WikiWord using metadata of the following format: { source:'selector', /* e.g. '#projectTitle' */ initial:'initial value', /* e.g. 'Project...' */ prefix:'string to be prefixed to the wiki word', /* e.g. 'Project' */ suffix:'string to be appended to the wiki word' /* e.g. 'AUTOINC0' */ } . ... This topic: System > JQueryPlugin > JQueryWikiWord . ... Copyright by the contributing authors. ...

Еще в разделе: (Показать все результаты (>1306) - wiki.cs.msu.ru/ )

• JQueryLoader < System < Foswiki

... Academic Departments . ... Partners . ... All partners . ... 02.12.2013 . Andrei Richter "The notion of freedom of (the media) in international law and policy" . ... Hannu Nieminen "Changes in the Regulatory Framework of Media and Communications: Four Explanatory Strategies and Six Researcher Profiles" . ... Awarding the titles of Honorary Professors of the Faculty of Journalism, Lomonosov Moscow State University: . ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>14) - www.journ.msu.ru/ )

• The Scholars Discussed the Media Ecology at the Faculty of Journalism ::
• Lecture of Alexander Laskin :: Department of Journalism, M. V. Lomonosov Moscow

... IUPAB) 28 ­ 2 2007, . IUPAB -. Ian C.P. Smith Ian C.P. Smith () () Henrik Flyvbjerg () () () () () () Joe Tien () () () () Erik Mosekilde () Leonardo Masotti () Michael Andre () () John Connally () ( ) () () Aaron Fenster () () Latchezar Avramov () Sylwester Sommer () Andrzej Wojcik () Stanislav Kozubek () Radostina Georgieva () 800. : ­ 1 2007, ­ 28 2007 http://www.msm.biophys.msu.ru dubna2007@biophys.msu.ru . 939-19-66 ...

Еще в разделе: (Показать все результаты (>6) - www.msm.biophys.msu.ru/ )

• Modern spectroscopy methods

... Перевод из другого вуза и между факультетами МГУ . ... В 1983 году приказом ректора МГУ С.Г. Тер-Минасова переводится с филологического на исторический факультет на должность заведующей кафедрой иностранных языков. ... Учебные программы курсов , читаемых в настоящее время на факультете иностранных языков и регионоведения МГУ имени М.В. Ломоносова: . ... Гимн факультета иностранных языков МГУ имени М.В. Ломоносова . ... Факультет иностранных языков и регионоведения МГУ имени М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>42) - ffl.msu.ru/ )

• About Us

... Faculty . ... News . ... 32-bit Microcontroller Programming . Microcontroller Control of Motors . Second-year students classes . ... Parallel Programming . ... Microcontroller Programming . ... Microcontroller-related . ... 2012/2013 . 2011/2012 . ... Serguey Elizarov . ... We sincerely wish you a Happy New Year and Merry Christmas! We hope that this year has been for you a year of new achievements. ... Happy New Year 2016! ... Senior Teacher of the Faculty of Physics at MSU,љ Cand. ...

Еще в разделе: (Показать все результаты (>69) - engineering.phys.msu.ru/ )

• Alexander Iovlev
• Alexander Monahov
• How can I get there

... Research . ... News . ... Home News Наука . ... 2006 . CLEO/Europe-EQEC Focus Meeting on Nonlinear, Quantum and Chaotic Optics: New Directions in Photonics and Optical Communications at ECOC 2006, 24-28 September 2006, Cannes-France . ... This CLEO/Europe-EQEC Focus meeting aims to respond directly to this need by providing a forum to discuss a range of important new concepts that may become critical to future optical communications systems. ... The submission deadline is 20 April 2006. ...

Еще в разделе: (Показать все результаты (>666) - ilc.phys.msu.ru/ )

• CCD detectors

... Security is rarely employed. l Advantages of globus_io ­ Ease of use of security, socket options, QoS ­ Easier Win32 portability ­ Very similar to existing BSD socket calls March 25, 2002 Globus ToolkitTM Developer Tutorial : Communication 2 Approach l l Provide familiar socket and file abstractions Provide both synchronous and asynchronous versions of everything ­ Can easily write code that will not block ...

Еще в разделе: (Показать все результаты (>16) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-02-Basics1.pdf
• http://acat02.sinp.msu.ru/presentations/ososkov/ACATOsoskov.doc
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-04-Security1.pdf

Open Conference Systems . Conference Help . ... Password . ... Conference Content Search . All Authors Title Abstract Index terms Full Text . ... Home . ... Account . ... Current Conferences . Home > Reset Password . For security reasons, this system emails a reset password to registered users, rather than recalling the current password. Enter your email address below to reset your password. A confirmation will be sent to this email address. Registered user's email . ...

Еще в разделе: (Показать все результаты (>9) - hea.phys.msu.su/ )

... Main practical applications of X-rays lie in the important for the society fields of medical imaging, custom, transport inspection and security. Scientific applications besides of fundamental research include material sciences, biomicroscopy, and protein crystallography. ... The first are relatively cheap, robust, and compact but have low brightness and poorly controlled photon spectrum. ... So accelerator based X- ray sources are mainly still used for scientific applications and X-ray tubes ? ...

Еще в разделе: (Показать все результаты (>4) - miles.sinp.msu.ru/ )

... РАН, профессор А.Н. Ширяев) 27 апреля - Dmitry Kramkov (Carnegie Mellon) A model for price impact. ... A typical financial model presumes that the prices of traded securities are not affected by an investor's buy and sell orders. ... We develop a continuous-time model for a large investor trading at market indifference prices. ... A key role is played by a stochastic differential equation for the market makers' utility process. ...

Еще в разделе: (Показать все результаты (>13) - new.math.msu.su/ )

• http://new.math.msu.su/content_root/programs/kaf/special/vichmat/rel-coz.doc

Composition of an Efficient Portfolio in the Bielecki and Pliska Market Model / Kambarbaeva G.S. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>3) - vestnik.math.msu.su/ )

... 7(846)333-54-27, E-mail: nikonovai@mail.ru In this paper we consider the matrix representation of the combinatorial expression of a finite sum, which includs the weighted powers of natural numbers with the same parameters, and reveal the properties of the recived representation by matrices, connected with invariancy of its components concerning the base numbers and parameters. ...

Еще в разделе: (Показать все результаты (>13) - www.mce.biophys.msu.ru/ )

Laboratory of Micro- and Nanofluidics . ... Moscow State University . ... Research . ... Ph.D. student, Junior Research Fellow . Type of research: . computer simulations . ... Alexander S. Potapov studied physics and nanotechnology at M.V.Lomonosov Moscow State University. In 2010, he joined our group to work on his Diploma project, in which he has modelled the electro-osmosis of thin wetting films. ... The same year he became a PhD student and was appointed as a junior research fellow. ...

Еще в разделе: (Показать все результаты (>17) - nanofluidics.phys.msu.ru/ )

• Alexander Vadimovich Kochergin
• Laboratory of Micro- and Nanofluidics
• Dubov

Alexander M. Kuznetsov . ... Sasha Kuznetsov entered a famous Theoretical Department of the Institute of Electrochemistry AN USSR in 1961, and joined Prof. R.R.Dogonadze group, They pioneered the quantum mechanical theory of electron transfer in solutions, which now became a general theory of in chemical, electrochemical and biological systems. ... Concludingly A.M. Kuznetsov is one of the pioneers and creators of quantum mechanical theory of charge transfer processes in condensed media. ...

Еще в разделе: (Показать все результаты (>29) - electr003.chem.msu.ru/ )

• Theoretical Department of the Institute of Electrochemistry AN USSR
• Selected Articles
• Alexander Mikhailovitch Kuznetsov (Sasha)

... About lab . ... Courses . ... Online Journal "Computer graphics and multimedia" (in russian) . Educational courses (in russian) . ... E-mail: avelizhev@graphics.cs.msu.ru . I work in Graphics and Media Lab and have participated in many projects of the lab concerning image processing, camera calibration, 3d reconstruction and laser scanning data processing . My research interests include computer vision, photogrammetry, image and laser scanning data processing. ... e-mail: . ...

Еще в разделе: (Показать все результаты (>70) - graphics.cs.msu.ru/ )

• Alexander Voronov | Graphics and Media Lab
• Alexander Chigorin | Graphics and Media Lab
• Alexander Parshin | Graphics and Media Lab

. Rus / Eng . 0 . 2013 . Impact Factor . Log In or Register . Main . Staff . Publications . Journals . Conferences . Contacts . Main . Staff . Publications . Journals . Conferences . Contacts . Publications . Articles . Back to the list . Inststitutskii per. 9, Dolgoprudnyi 141700, Russia . a-p-ivanov@inbox.ru . Main . Staff . Publications . Journals . Conferences . Contacts . Institute of Computer Science Izhevsk, 2005 - 2016 .

Еще в разделе: (Показать все результаты (>24) - ics.org.ru/ )

• Institute of Computer Sciences - Staff - Korotkov Alexander G.
• Institute of Computer Sciences - Staff - Shaura Alexander S
• Institute of Computer Sciences - Staff - Kilin Alexander Alexandrovich