Title Author Key words The Other as a margin and as a marginal experience in the process of sociocultural identity formation L.Ya. ... The author singles out four basic dimensions of identity phenomenon in the frame of the proposed approach. These dimensions are located in the range between oppositional notions: individual collective, internal external, content boundary, static nature dynamic nature. ... Also the functions of the Other in the process of identity formation are revealed. ...
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
... 2000 August 30 . The Brown Dwarfs of Orion's Trapezium . ... NICMOS IDT , NASA . ... Explanation: The bright stars above are well known as heart of the Trapezium , an open cluster of stars in the center of the Orion Nebula . ... Although many more brown dwarfs than hot stars have now been found in Orion, their very low masses make them inadequate to compose much of the dark matter expected in galaxies and the Universe . ... About APOD | ... NASA Technical Rep.: ...
LUT Summer School: www.lut.fi/summerschool summerschool@lut.fi Guide for Student Advisers Greetings from your colleagues at Lappeenranta University of Technology! ... With the wide-ranging selection of courses on-offer during the LUT Summer School we aim to both challenge and inspire students. ... Lappeenranta and LUT Lappeenranta is located some 220 km northeast of Finland's capital, and about 230 km northwest of St. Petersburg, Russia. ... The fee will be given on the LUT Summer School web pages. ...
[
Текст
]
Ссылки http://www.phys.msu.ru/rus/about/structure/admin/OTDEL-FOREIGN/INVITATIONS/LUT_Summer_School_2013_staff.pdf -- 448.5 Кб -- 17.01.2013 Похожие документы
... Geography of World Economy . ... Recreational Geography and International Tourism . ... Departments . About Faculty . ... Field training . ... Type of field courses . ... The training for Bachelor’s and Master’s Degrees is carried out in the 5 main directions: Geography, Geography and Cartography, Hydrometeorology, Environmental and Natural Resources Management, Tourism. ... Furthermore, there is an opportunity to undertake training courses in the various departments of the Faculty. ...
... Projects . ... CURRENT GRANT PROJECTS . Grant project RFBR 14-01-00738-а . ... The purpose of the project is to continue joint experimental and numerical studies of sub- and supersonic flows of air plasma, carbon dioxide plasma and nitrogen plasma and heat transfer where possible nonequilibrium chemical processes in the flow and on the surface of thermal-protective materials in an extended range of conditions implemented in the induction HF plasmatrons IPG-4 (IPM RAS) and WT VAT-104 (TsAGI). ...
Lomonosov project . ... Scientific goals . ... Gamma-bursts . ... Scientific equipment . ... BDRG . ... ShOK . ... Information unit (BI) . ... Three complexes of scientific equipment onboard ?Lomonosov? satellite will provide multi-wave measurements of gamma-bursts , which are necessary for the studies of the nature of these astrophysical sources. These complexes are BDRG, ShOK and UFFO providing gamma-bursts? measurements within optics, gamma, X-ray and UV-ranges of electromagnetic spectrum. ...
... This paper argues that a mixed system of private and state universities seems the best structure to secure dynamism, accessability, and efficiency of higher education insitutions in post-industrial societies. ... Whereas the university system of Germany is to a large degree state-operated, the British system combines some elements of private higher education with an also largely state-operated university system. ... The United States would seem to provide the best structure for a university system. ...
Geology at Moscow State University . Departments . ... Geology and geochemistry of ore deposits . ... Mineralogy . ... research institutes, and other organizations.The researchers are conducted by the members of several scientific groups which deal with diamond deposits , mineralogy and genetic crystal chemistry of rare elements, experimental thermodynamics and thermochemistry of minerals , genetic mineralogy , spectroscopy of minerals , and mineralogy of porphyry-copper deposits ...
... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... X-COM: Distributed Computing Software . ... In mellow autumn time Moscow cordially invites HPC specialists to take part in Russian Supercomputing Days, the brand new international supercomputing conference that unites several traditional Russian and international HPC events. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ... Russian Supercomputing Days International Conference . ...
HBT 10 .. 2015 - ALICE LHC- QGP, QGP 1 fm/c 5 fm/c 10 fm/c 50 fm/c " " - . ... Rout / Rside ~ sensitive to emission duration. ... Rout/Rside 1 ALICE - Phys.Lett.B696:328-337,2011 Heavy Ions STAR and ALICE, 200 and 2760 GeV · All the expected trends are observed: Overall increase of the radii as compared to RHIC Strong dependence of the radii on kT Rout/Rside ratio even smaller than the one at RHIC 04/11/2011 P. Boek,Phys.Rev. C83 (2011) 044910 3D relativistic viscous hydrodynamics. ...
[
Текст
]
Ссылки http://lav01.sinp.msu.ru/~vlk/LECT_2015_new/lect_10_2015_HBT-corr.pdf -- 1567.7 Кб -- 31.03.2015 Похожие документы
Sign in Register . ... Resources . ... 495) 3334-65-56 . info@ecfs.msu.ru . All contacts . ... Home Brown Lynn . Brown . Lynn . Registered: 13 january 2016 in 21:15 . Activity: The last time was on site 07 february 2016 in 23:17 . ... Contacts . The Department of land resources . ...
Geant4 toolkit for simulation of HEP experiments V.Ivanchenko From name of Geant4 collaboration BINP, Novosibirsk, Russia & CERN, Geneve, Switzerland Outline Geant4 history Design and tools Geant4 physics June 2002 release Prospects for future June,24 ACAT-2002 V.Ivanchenko Geant4 2 History 90th: About 100 FORTRAN MC programs in the world. The most popular in HEP GEANT3. ...
Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . You may download the latest source code distribution and install the period search service at your own web server. ...
... 4] Recently, we introduced orthometalated complexes of PdII and PtII as mimetics of metal-dependent esterases. ... 5] However, the rates of hydrolysis of amino acid esters were not very striking, although the catalysts had features typical of metallohydrolases.[5b] It could be argued that a square-planar metal configuration, which is not reported in enzymes, is less favorable for catalysis, and that PdII and PtII are Єsoftє acids which require Єsofterє bases for efficient catalysis. ... Chem. ...
... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...
... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...
Human longevity at the cost of reproductive success: evidence from global data ц б F . ... Abstract A trade-off between reproduction and somatic maintenance and hence survival is fundamental to life-history theory. We investigated the relationship between female fecundity and longevity in Homo sapiens using data from 153 countries located all over the world. The raw correlation between life span and fecundity was highly signi®cant with a negative trend. ... 1998; Polis et al., ...
[
Текст
]
Ссылки http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2000_Longev_JEvolBio.pdf -- 97.8 Кб -- 16.03.2009 Похожие документы