... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>25) - rswater.phys.msu.ru/ )

• Group of laser spectroscopy of solutions of supramolecular compounds and

... О Школе . ... ВШБ МГУ - школе . ... Результаты вступительного экзамена в Школу юного менеджера . По результатам вступительного экзамена на программу "Школа юного менеджера", наивысшее количество баллов набрали следующие абитуриенты: . ...

Еще в разделе: (Показать все результаты (>92) - www.mgubs.ru/ )

. [ Войти ] . Главная -> Фильмы -> Henry Aldrich, Editor . Пользователи . Демо . Деньги . Фильмы . Форум . Henry Aldrich, Editor . США 1942 . отметить . Комедия .

Еще в разделе: (Показать все результаты (>362) - kinfo.ru/ )

• Just Follow Law: Wo zai zhen.. - Фильмы - Kinfo.ru
• Follow the Prophet - Фильмы - Kinfo.ru
• Following the Rabbit-Proof F.. - Фильмы - Kinfo.ru

... 2013/04/16 - 11:59am . ... After the education at High School of Management and Innovation graduates receive the state approved diploma of Lomonosov Moscow State University for a specialized educational programme "Strategic Management and Innovation" and become "Masters of Management". ... Admission procedure in 2013 in direction of "Management" for the programme "Strategic Management and Innovation" provides for contracts with 50 persons . ... 2006-2016 MSU Higher School of Management and...

Еще в разделе: (Показать все результаты (>28) - hsmi.msu.ru/ )

• Opening of the educational programme - School of CEOs, "Capsule of security"
• School overview | MSU Higher school of management and innovation

... of engineering and ecological geology . ... Department of Engineering and Ecological Geology invites foreign students for training programs. During education the students of the Department gain both fundamental and applied knowledge by the following specializations: Engineering Geology, Soilscience and Soil Stabilization, Environmental Geology and Ecological Geology. ... Korolev V.A. 5 . ... Isotope methods in engineering geology . ... Mathematical methods and computers in engineering geology . ...

Еще в разделе: (Показать все результаты (>100) - www.geol.msu.ru/ )

• Faculty of Geology >> Departments
• Faculty of Geology >> Geology at Moscow State University
• Faculty of geology Moscow State Lomonosov University

... Introduction As is well known, according to Special Relativity (SR) a transition from an immovable reference system to any moving one may by interpreted as some rotation in the Minkowski space. ... In fact, when we come from an immovable reference system to any moving one, the tme axis turns on the angle depending on velocity, and the light world line must stay the bisectrix. ... Besides, the new distances along the new time axis between light cones will not equal to the old ones. ...

Еще в разделе: (Показать все результаты (>395) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/bernstein_physicist.pdf
• M.Shulman
• M. H. Shulman

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>13) - iconolat13.phys.msu.ru/ )

... Nonlinear fiber optics . ... member of the Editorial Board for the Laser Physics journal . ... Member of the steering committee of the international conference on Raman spectroscopy (ICORS): Budapest, 2002; Brisbane, 2004; Yokohama, 2006; London, 2008 . Member of the steering committee of the International Laser Physics workshop: Bratislava, 2002; Hamburg, 2003; Trieste, 2004; Kyoto, 2005; Lausanne, 2006; Leon, 2007; Trondheim, 2008; Barcelona, 2009 . ... International conference ?Laser Optics? ...

Еще в разделе: (Показать все результаты (>5) - photonicslab.phys.msu.ru/ )

... School problem is extremely important. ... Our President has mentioned the territorial disparity, i.e. two-thirds of our schools are the rural schools and their graduates are at unequal terms with their equals from cities' schools to get following education. ... Create special conditions in education for disabled children, for orphans and children from unfortunate families, pupils from rural schools and gifted children. ... Ensure social equity for all children during school education and after it. ...

Еще в разделе: (Показать все результаты (>41) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/396.doc
• http://www.rsr-online.ru/doc/2010_10_07/24.pdf
• http://www.rsr-online.ru/doc/norm/94.doc

... MSU, Faculty of Soil Science, Russia, 119991, Moscow, GSP-1, 1-12 Leninskie Gory . ... The Faculty is a leading institution in soil science and ecology. ... Assessment of land resources involves evaluation of soil quality, its economic and ecological assessment and cost estimation. ... Soil science lays the basis for rational land use, which requires knowledge of soil condition and economic and ecological estimation of land resources, including landscape characteristics and their aesthetic role. ...

Еще в разделе: (Показать все результаты (>118) - www.msu.ru/ )

• School of Television
• Faculty of Law
• Faculty of Political Science

General Information . ... Program . ... Symposium expenses . ... Presentation information . ... Cultural Program . Travel information . Contact information . 14 European Symposium on . Gas Phase Electron Diffraction . ... A0 (84 cm width 120 cm height) . ... A1 (59 cm width 84 cm height) . ...

Еще в разделе: (Показать все результаты (>15) - ged.chem.msu.ru/ )

• News. 14 European Symposium on Gas Phase Electron Diffraction
• Important deadlines. 14 European Symposium on Gas Phase Electron Diffraction

Irena Lasiecka ( University of Virginia ) . Nikolai Melnikov (CEMI / MSU) . Mikhail Zelikin (MSU / Steklov Institute) . G. Avalos ( University of Nebraska , USA ) . V. Borisov (MSU, Moscow) . ... O. Emanouvilov ( Colorado State University , USA ) . A. Fursikov (MSU, Moscow) S. Hansen ( Iowa State University , USA ) R. Hildebrand ( Joseph Fourier University , France) V. Komornik ( University of Strassburg, France ) A. Kowalewski ( Institute of Automatics, Poland ) . ... Moscow) . ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.su/ )

Lessons learned from the Thirty Meter Telescope site testing Tony Travouillon Sebastian Els, Angel Otarola, Reed Riddle, Matthias Schoeck, Warren Skidmore TMT.XXX.PRE.05.0XX.DRF01 1 Introduction TMT and its Site testing. Important choice before going on site. ... Considerations during analysis of the data. TMT.XXX.PRE.05.0XX.DRF01 2 Some Background about the TMT Site Testing TMT is a 30m, segmented, RitcheyChretien telescope design. ... ASCA Cloud Cover Analysis So how do we do it in practice? ...

Еще в разделе: (Показать все результаты (>20) - site2010.sai.msu.ru/ )

. Jump to Navigation . Chair of Computer Methods of Physics . Department of Physics, M.V. Lomonosov Moscow State University . Create new account . Log in . Request new password (active tab) . Username or e-mail address * CAPTCHA . This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Main . Contacts . Department of Physics M.V. Lomonosov Moscow State University , Chair of Computer Methods of Physics , 2014 . Found an error? Let us know ! . Login .

Еще в разделе: (Показать все результаты (>5) - cmp.phys.msu.ru/ )

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

... Mathematical Theory of Feedback Control . ... Annotation: this course is about mathematical equations of atmospheric diffusion which allow modeling of the problems of environment. ... The course reflects the experience and the point of view of a research group in the field of mathematical modeling of Western, Soviet and later Russian economics. ... Such approach captures the behavior of rather complex systems. ... Scientific Seminar: Mathematical Modeling of Complex Systems . ...

Еще в разделе: (Показать все результаты (>118) - hcs.cmc.msu.ru/ )

• Master Education | Магистерское и послевузовское образование Entrance
• Master program "Enterprise Information Systems" | Магистерское и послевузовское

... The "Mulliken" AMMs up to the fourth order were calculated within the scheme developed by Saunders et al. [13] using the B3LYP, Perdew-Wang (PW91), and Perdew-BurkeErnzerhof (PBE) functionals with the 6-21G** basis set (for shortness, noted below basis set 3 or BS3) for all ALPOs, while the ATN and ATO structures were also considered at other levels as STO-3G (BS1), 3-21G (BS2), and 8-511G*(Al)/8-521G*(P)/8411G*(O) (BS4) for comparison. ... No EP convergence with the basis set was observed. ...

Еще в разделе: (Показать все результаты (>18) - beams.chem.msu.ru/ )

... Snecma Moteurs (Groupe Snecma, France) . ... The Colloquium-458, organized by EUROMECH , will take place at Institute of Mechanics of Lomonosov Moscow State University (MSU) . ... The subjects of the Colloquium-458 cover important problems dealing with the verification of constitutive equations, the organization of experiments, the connection between microstructures and mechanical properties and the effective utilization of the modern FEM packages. ... France. ... S.-Petersburg State Techn. ...

Еще в разделе: (Показать все результаты (>2) - www.imec.msu.ru/ )

• "Advanced Methods in Validation and Identification of Nonlinear Constitutive

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>191) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help
• MUSCLE 3.6