... COHO data . ... OMNI data . OMNI Data Set . LASRE data . ... Magnetic Storms Data . Satellite Informations Selector . ... OMNI data format description can be found here . ... 1 IMF and Plasma data, same spacecraft . 2 IMF and Plasma data, different spacecraft . 3 No Plasma data . ... 5 No IMF or Plasma data . ... Degrees (GSE coords) . ... sigma|B| . ... Degrees, GSE*, i.e. positive from from -X to Y or positive . ... Degrees, GSE, . ... Proton flux . ... Access to OMNI-2 data . ...

Еще в разделе: (Показать все результаты (>7) - dbserv.sinp.msu.ru/ )

Антонов А.С. Параллельное программирование с использованием технологии MPI: Учебное пособие. М.: Изд-во МГУ, 2004.-71с. Антонов А.С. Практический курс MPI. ... М.: Изд-во МГУ, 1991.-345с. Воеводин В.В. Параллельные структуры алгоритмов и программ. ... J. Choi, J. Dongarra, and D. Walker, PB-BLAS: A Set of Parallel Block Basic Linear Algebra Subroutines, Practice and Experience, 8 (1996), pp. 517-535. http://www.netlib.org/scalapack/html/pblas_qref.html/. ...

Еще в разделе: (Показать все результаты (>105) - num-anal.srcc.msu.ru/ )

• БЧА НИВЦ МГУ. SF62R. Интегральные и связанные с ними функции
• БЧА НИВЦ МГУ. SF62R_P. Интегральные и связанные с ними функции

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | ... CDFE: Online Services . ... Coded (machine-retrievable) information . ... DATA . ... This appendix provides a listing of all information-identifier keywords, along with details about their use. ... The general format of the coding string consists of three major fields which may be preceded by a decay flag: ((decay flag)nuclide,half-life,radiation). ... Gives information on references that contain information about the data coded. ...

Еще в разделе: (Показать все результаты (>28) - cdfe.sinp.msu.ru/ )

• CDFE - Centre for Photonuclear Experiments Data - Home page
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => Nucleus Ground State Parameters

M. A. Vorotyntsev 1 1,2,3, D. V. Konev3, M. Skompska 4 ICMUB-UMR 6302 CNRS, Universite de Bourgogne, Dijon, France 2 M. V. Lomonosov Moscow State University, Russia 3 Institute for Problems of Chemical Physics, Chernogolovka, Russia 4 University of Warsaw, Poland mivo2010@yandex.com, mv@elch.chem.msu.ru, mv@u-bourgogne.fr In situ measurements of specific conductivity of films on electrode surface Specific conductivity: function of potential Impedance problems: 1. ... Which thickness? ...

Еще в разделе: (Показать все результаты (>65) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/spec/Vvedenie_v_spetsialnost_2/Measurements_of_pH.pdf
• http://www.elch.chem.msu.ru/rus/spec/Vvedenie_v_spetsialnost_2/CritRevAnalytChem-1981.pdf
• http://www.elch.chem.msu.ru/rus/7_8_2009_supplement.pdf

... On-line консультант . ... Приглашаем всех, интересующихся исследованиями и разработками в области компьютерных сетей, принять участие в семинаре по software-defined networking, который состоится 4 июля 2011 (понедельник) в 19.30 в Политехническом музее (Новая площадь, д 34;, подъезд 9, малая аудитория). ... We are about to witness a revolution in the networking towards so-called "Software Defined Networking" (SDN). SDN enables innovation in all kinds of networks . ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>2) - erp.cmc.msu.ru/ )

The Chair of Mathematical Theory of Intelligent Systems and . ... Mikhalev A.A. , Zolotykh A.A. A system of algorithms for symbolic calculations in Lie superalgebras. 3rd International Workshop New Computer Technologies in Control Systems. ... Mikhalev A.A. , Zolotykh A.A. Complement algorithms for primitive systems of elements of free Lie algebras with respect to a free generating set. ... Mikhalev A.A. , Zolotykh A.A. Algorithms for primitive elements of free Lie algebras and Lie superalgebras. ...

Еще в разделе: (Показать все результаты (>66) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Интеллектуальные системы :: Сотрудники :: Золотых Андрей Алексеевич
• Intelligent Systems :: Research :: :: Articles

Innovations in Distributed Computing . Computational and Data Intensive GRIDs . Challenge of LHC Computing and GRID . ... Parallel Computing Technologies and Applications . ... Evolutionary and Genetic Algorithms . Wavelet Analysis . New Human Interfaces, Virtual Reality . ... Automatic Computation Systems: from Feynman Diagrams to Events . ... Computer Algebra Techniques and Applications . ... Signal Significance . Separation of Signal from Background, Rare Events . ...

Еще в разделе: (Показать все результаты (>64) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/tyupikova/doclad.doc
• http://acat02.sinp.msu.ru/presentations/ivanchenko/iv.pdf
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-07-DataManagement1.pdf

... 2000 September 10 . White Dwarf Stars Cool . ... WFPC2 , HST , NASA . Explanation: Diminutive by stellar standards , white dwarf stars are also intensely hot ... but they are cooling. ... Here, researchers have discovered a large concentration of white dwarf stars (circled above). ... Studying how these stars cool could lead to a better understanding of their ages, of the age of their parent globular cluster , and even the age of our universe . ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>30) - www.arcetri.astro.it/ )

... id #527 . Journal of Biological Standardization [not defined] . Common information . ... no information] . ... since 1900-01-01 till today . ... http://www.sciencedirect.com/science/.. ... 1973-01-01 . 1989-12-31 . ...

Еще в разделе: (Показать все результаты (>11) - journals.genebee.msu.ru/ )

GRID WARPING FOR IMAGE SHARPENING USING ONE-DIMENSIONAL APPROACH Andrey Krylov, Alexandra Nasonova and Andrey Nasonov Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Email: kryl@cs.msu.ru ABSTRACT A new method for image sharpening via image warping is proposed. ... The aim of the proposed method is to transform edge points coordinates in such a way that the slope of the edge becomes steeper (see Fig. ...

Еще в разделе: (Показать все результаты (>109) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2015.OGRW.Krylov_Nasonova_Nasonov.Warping.en.pdf
• http://imaging.cs.msu.ru/pub/2012.PRIA.Nasonov_Krylov.EdgeMetrics.en.pdf
• http://imaging.cs.msu.ru/pub/2009.Graphicon.Krylov_Nasonov.IntComb.en.pdf

... The study of adaptive variability, i.e. the study on the population level of the physiological adaptation of the human organism to a variety of environmental conditions, is the main purpose and the basic principle of physiological anthropology. ... Regional rates of hormonal activity of indigenous population of different ethno-territorial groups that we have elaborated broaden our notions about common conformities of age variability and aging and the reasons of these processes. ...

Еще в разделе: (Показать все результаты (>28) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/vestnic/e2014_1.doc
• http://www.antropos.msu.ru/vestnic/e2014_4.doc
• http://www.antropos.msu.ru/vestnic/e2015_1.doc

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>4) - textbook.sinp.msu.ru/ )

... Expanding and Retaining Customer Loyalty with Stefan Legner of InterNetX . Legner started with a brief history of InterNetX, a Regensburg, Germany based hosting and domain registrar provider that has more than 19,500 customers worldwide.He emphasized the need for companies to build long term partnerships, adding that business has always been about the relationship between people rather than companies .Where possible, Legner said that companies should provide an ... cheap the north face . ...

Еще в разделе: (Показать все результаты (>116) - elana.sinp.msu.ru/ )

• cheap ray bans uk as well as two kinds of noctilionid bats | С Днем Победы!
• I?m much more into talking than listening | С Днем Победы!
• editor | С Днем Победы!

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>76) - geophys.geol.msu.ru/ )

• TES. Field example.
• TRF_2d. Page 4.
• TES tecnology. MSU.

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• Align tool for DNA-protein complexes
• Nhunt

... TWO USES OF ANCIENT ASTRONOMY . ... Limitations inciude lack of veracity in many records, errors in dating events, and uncertainty in calculating the circumstances of ancient eclipses of the Sun. ... Thus, in this paper, I shall discuss two and only two uses of ancient astronomy. ... This is the same as the time-equivalent precision of a solar eclipse, and hence an Islamic time observation is entitled to the same statistical weight as an observation of a total solar eclipse at a known point. ...

Еще в разделе: (Показать все результаты (>85) - hbar.phys.msu.ru/ )

• R.R.Newton, "Astronomical evidence..."
• newtrev2.htm
• Robert R. Newton, The Secular Acceleration of the Earth's Spin

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

Chemistry 460 Spring 2013 Dr. Jean M. Standard April 25, 2013 Basis Set Notation Using the LCAO-MO approximation, molecular orbitals can be represented as linear combinations of atomic orbitals, K i = µ =1 c µi f µ . 1) In this equation, the functions i are molecular orbitals, f µ are atomic orbitals, c µi are numerical coefficients, and K is the total number of atomic orbital functions (or basis functions). ... The orbital exponent controls the size of the basis function. ...

Еще в разделе: (Показать все результаты (>30) - erg.biophys.msu.ru/ )

• Using spherical functions (from A.Granovsky manual) ERG Research Group:
• Python script for processing FRAP image set ERG Research Group: Лаборатория

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>21) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/rcx_advices.pdf
• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf

... The Sixth International Conference «Scientific Issues in Security and Combating Terrorism », Moscow, 11 - 12th of November, 2010 The Council of Europe approach to the international information security in the context of the fight against terrorism Ms. Marta Requena, Head of the Public International Law and Anti- Terrorism Division Head of the Counter Terrorism Task Force, Council of ... States certainly remain the principle actors of the fight against terrorism. ...

Еще в разделе: (Показать все результаты (>9) - www.iisi.msu.ru/ )