... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>2) - mouse.genebee.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>161) - www.genebee.msu.ru/ )

• Notes on searching by similarity
• GeneBee Graphical Alignment - Advanced
• Tumor necrosis factor (TNF) is an inflammatory cytokine that can induce cells

... Potts-glass models of neural networks. ... FIXED POINTS OF PNN [pic] For any [pic], the only fixed points of a network constructed with the aid of two patterns [pic] and [pic] are these patterns themselves (and their negatives [pic]). [pic] Let us examine a case, when q = 2 and the vectors [pic] are without the signs [pic] (the signals are without the phase failure): [pic] As the neurons possess only one of the two values [pic] or [pic], formally this case is alike the Hopfield model. ...

Еще в разделе: (Показать все результаты (>49) - acat02.sinp.msu.ru/ )

Diploma thesis abstract Kostylev Andrey Yurievich Spatial field distribution laser beam control by means of electrically driven phase elements In this work we present results of experimental formation of beams with vortex wave front dislocation by means of phase optical elements: spiral phase plate, bimorph adaptive mirror, controlled liquid crystal modulator. ... Gerchberg-Saxton algorithm has been implemented to determine required liquid crystal modulator phase. ...

Еще в разделе: (Показать все результаты (>96) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2010/Yagnyatinskiy_Konovko_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2011/Smetanina_Kandidov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2014/Spirkov_Kandidov_en.pdf

. Numerical methods of research on heat and mass intensification processes in power units. Book “Numerical simulation of vertical intensification of heat transfer in tube packages” . Numerical simulation results of heat transfer intensification on “eddy generating” surfaces with different turbulence models application. Heat and hydrodynamic pattern at flowing over the cylinder with “eddy generating” elements

Еще в разделе: (Показать все результаты (>3) - termogaz.imec.msu.ru/ )

... Russia as well as other countries of the world was actively combating the economic downturn. ... And the country still has an amount of reserves that will feed us for several years to come. ... Countries of South-East Asia, China develop dynamically. Even in crisis times their growth rate made 8%. ... We, on the contrary, practice a very conservative approach the reserves are a kind of sacred cow: they cannot be used for anything except exchange rate regulation, which is erroneous. ...

Еще в разделе: (Показать все результаты (>15) - www.mse-msu.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>8) - physcontrol.phys.msu.ru/ )

• List All Categories
• Features

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Verkuil Yvonne I. , Karlionova Natalia, Rakhimberdiev Eldar N. , Jukema Joop , Wijmenga Jan J. , W Jos C. , Pinchuk Pavel , Wymenga Eddy , Baker Allan J. , Piersma Theunis . ...

Еще в разделе: (Показать все результаты (>1977) - istina.msu.ru/ )

• Vorobjev G.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Goncharenko E.N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• BIOSYSTEMS - журнал | ИСТИНА - Интеллектуальная Система Тематического

Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>2) - swx.sinp.msu.ru/ )

... Online Services | ... Construct your query and output by sequental openings of needed fields. One output field must be selected (not be blank) at least. ... Query parameters: . Select for output . ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ... Excited energy(keV) . ...

Еще в разделе: (Показать все результаты (>16) - cdfe.sinp.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Рег.: ... Рейтинг: -15 . Получил Права . ... Re: Получил Права [ re: muse ] . ... Re: Получил Права [ re: darktemplar ] . ... Re: Получил Права [ re: heGoat ] . ... Права . ...

Еще в разделе: (Показать все результаты (>2892) - www.snto-msu.net/ )

• nfs mw по сети - Public forum of MSU united student networks
• Про Москву на expat.ru - Public forum of MSU united student networks
• Подготовка к НГ - Public forum of MSU united student networks

Psychology in Russia: State of the Art · 2009 From reFlec tory ring to multivariable system natoly I. Nazarov Dubna International University of Nature, Society, and Man Dubna Some special features of feedback functioning in live movement control are discussed. ... The main role here play human perception of the information resulted from movement performance on the level of motor-sensory transition, when multidimensional vector of muscle dynamics transforms into dynamics of outer object environment. ...

Еще в разделе: (Показать все результаты (>142) - www.psy.msu.ru/ )

• Program of conference 'Alexander R. Luria and psychology in the 21st century'
• Варианты вступительного экзамена по английскому языку, 2001

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>160) - www.pereplet.ru/ )

In memory of Sasha Kuznetsov . Only two days ago I came back from a visit abroad to the sorrowful news that our long-time good colleague and friend, a sparkling and noble personality, Alexander Mikhailovitch Kuznetsov, to me and many others, Sasha, had passed away. ... This applied both to his own realm of molecular charge transfer phenomena but also in his interests in broader areas of condensed matter chemical physics. ... Sasha enjoyed high and increasing international respect. ... Back ...

Еще в разделе: (Показать все результаты (>61) - electr003.chem.msu.ru/ )

• Theory as a Lighthouse in the Electrochemical Ocean
• Oleg A. Petrii
• Boris B. Damaskin

... For n 3, we define An by An = {P = (a1, . ... S1 3 Example. ... 4 The symplectic form We define the canonical symplectic form n 2(Mn) as follows. ... X, ) a symplectic manifold with dimR X = 2k. · T k = (S 1)k · µ : X Rk · Vol(µ(X )) (X, ) preserving . ... Vol(n) that n Rn-3 is a convex p olywhich is defined by triangle inequalHence we can calculate the rightside by multiple integral. ... 13 Another pro of of the main theorem Hereafter n is o dd and all cohomology groups are with R-co efficients. ...

Еще в разделе: (Показать все результаты (>146) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/TTC/slides/terzic.pdf
• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/2011/Bozhenko-et-al-1101.2576v1.pdf
• http://higeom.math.msu.su/people/taras/talks/2004oberwolfach-talk.pdf

... The circumnuclear GASEOUS disks are often decoupled from the circumnuclear stellar disks and are even stronger inclined to the outer disk planes; in fact, we have found a considerable `population' of inner polar rings. Inner gas polar rings are found as in spiral galaxies with the massive outer gas disks co-planar to the main symmetry planes (e.g. NGC 2841, Sil'chenko et al. 1997, and NGC 7217, Sil'chenko & Afanasiev 2000) as well in many lenticular galaxies (Fig. ...

Еще в разделе: (Показать все результаты (>51) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/203546.ps.gz
• http://sn.sai.msu.ru/~sil/preprints/n7217_aa.ps.gz
• http://sn.sai.msu.ru/~sil/preprints/counter.pdf

... Scanning probe microscopy (SPM) allows the visualization of single protein molecules and their complexes with membranes. ... Antibodies . ... Self-assembly in protein-membrane systems . ... Self-assembled nanostructures form from membrane proteins, e.g. ATP-syntase and cytochrome P450 [5]. ... Kiselyova O.I., Yaminsky I.V. "Proteins and memrane-protein complexes" in Scanning Probe Microscopy of Biopolymers (Ed. by Yaminsky I.V., Scientific World, Moscow, 1997) p. 41. (in Russian). ...

Еще в разделе: (Показать все результаты (>78) - www.spm.genebee.msu.ru/ )

• AFM studies of DNA condensation
• Image formation and processing methods
• Files Quick Viewing

... Программа повышения квалификации ?Исследование природы вместе с детьми? ... День леса - 2013 . ... Содержание сборника, 2004 . ... из сборника Вместе со всей планетой , Пущино 1995 . ... Загадки и тайны мира природы очень интересны детям, даже самым маленьким. ... В 1995 г. мы вместе с учеными подмосковного города Пущино помогали школьникам выступить в роли экологических наставников для малышей . Заметка об этой работе была опубликована в журнале ЮНЕСКО Connect . ...

Еще в разделе: (Показать все результаты (>2) - kids.genebee.msu.ru/ )

Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo theory: From large-scale to small-scale dynamos, Spa. ... Rev., 169, N 1-4, 123 - 157, 2012 . ... High resolution simulations of small-scale and large-scale dynamo action in periodic domains are compared with each other and contrasted with similar results at low magnetic Prandtl numbers. ... These differences are found to be independent of whether or not there is large-scale dynamo action. ...

Еще в разделе: (Показать все результаты (>58) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K. Current status of turbulent dynamo
• Laboratory of Systems for Automated Image Processing
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of

Q: Recently I read a book called ?C14-CrashЃ by Christian Bloess and Hans-Ulrich Niemitz (there is a summary in German with figures on . ... Briefly, the authors claim that the majority of the original assumptions made by Libby for the radiocarbon . ... directly calculated from a C14 value." ... such fractions are used for calibrations and dating. ... used for radiocarbon calibration. ... important after atmosphere reservoir - upper ocean. ... radiocarbon content in the atmosphere. ...

Еще в разделе: (Показать все результаты (>87) - hbar.phys.msu.ru/ )

• newtrev1.htm