Book Review Struct Multidisc Optim 28, 372 ­ 373 (2004) DOI 10.1007/s00158-004-0451-7 A.P. Seyranian and A.A. Mailybaev: "Multiparameter Stability Theory with Mechanical Applications" World Scientific Publishing Co. ... A remarkable feature of the book is the authors' presentation of a new multiparameter bifurcation theory of eigenvalues, which is a key point for the stability and instability studies. ... The material of the book is organized into 12 chapters. ...

Еще в разделе: (Показать все результаты (>31) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/MailybaevEtAl2005.pdf
• Curriculum Vitae of Dr Alexei A

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>33) - foroff.phys.msu.ru/ )

• Программы спецкурсов физического факультета МГУ

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ­ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./vorontchuk.pdf

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>28) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• APEV service - Space monitoring data center

Support ] [ Links to DC resistivity and IP software in WWW ] . ... TRF_2D for Windows - Automated 2D Inversion Program for VES Travers Data. ... The scientists of the laboratory are developing algorithms and computer programs for decision of forward and inverse problems of resistivity and induced polarization methods, which are widely known in Russia and are applied in many countries abroad. ... IE2DL - the set of the programs for resistivity and IP data modeling in 2D inhomogeneous media . ...

Еще в разделе: (Показать все результаты (>98) - www.geol.msu.ru/ )

• Faculty of Geology >> Departments

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>16) - npidb.belozersky.msu.ru/ )

• NPIDB: List of complexes
• NPIDB: Help

Lunar Base Development Issues, Technology Requirements, and Research Needs Peter Eckart[1] Abstract The development, design, and construction of a lunar base will be an extremely complex technical task. ... Eckart, 1999] Lunar Extra-vehicular Activities (EVAs) & Surface Transportation Systems The definition and development of space suits, portable life support systems (PLSS), and surface transportation systems can draw extensively from experiences gained during the Apollo missions. ...

Еще в разделе: (Показать все результаты (>91) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/peter.pdf
• http://selena.sai.msu.ru/Bus/Publications/UFN2007(Bus_etal)(engl).PDF
• http://selena.sai.msu.ru/Shev/Publications/ms34/MS064.pdf

... Инерциальная экваториальная система . ... Координатная системя задается направлением одной из осей и напревлением другой оси в плоскости, нормальной к первой. ... Система Geographic Coordinate system (GEO) задана осью X ,проходящей через Гринвичский меридиан в плоскости экватора (0њ долготы). ... В система Geomagnetic Coordinate system (MAG) ось Z параллельна оси магнитного диполя. ... Система GSM (The Geocentric Solar Magnetospheric System), как и GSE и GSEQ имеет ось X направленную на Солнце. ...

Еще в разделе: (Показать все результаты (>72) - www.kosmofizika.ru/ )

• A Dictionary of Measures, Units and Conversions

... Acoustic Nonlinearity, Attenuation and Scattering of a Sound in Water with Vapor-Gas Bubbles . ... Nonlinear effects, attenuation and scattering of a sound, originated in propagating of a sound in a liquid with vapor-gas bubbles, are investigated. A liquid with phase inclusions near to phase transition represents an example of complex media, when at determination of the acoustic characteristics it should take into account phase transformations. ...

Еще в разделе: (Показать все результаты (>143) - acs366.phys.msu.su/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>22) - comphep.sinp.msu.ru/ )

• tutorials [CompHEP]

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Research laboratories . ... Complex Mapping Integrated Mapping Laboratory is one of the oldest departments of the faculty. ... In connection with the deployment of atlas mapping in 1964 the laboratory was transformed into the Problem Research Laboratory of Integrated Mapping and Atlases. ... In 1994, it was renamed to the Integrated Mapping Laboratory. ... Moscow,...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• World Data Center for Geography
• Department of Land Hydrology
• Recreational Geography and Tourism

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>61) - scon155.phys.msu.su/ )

... You should add the following lines to your PC GAMESS/Firefly job: $ELDENS IEDEN=1 $END $ELPOT IEPOT=1 $END $CUBE CUBE=.T. mesh=coarse $END This will produce cube info for both density and ESP. You can choose to specify only $ELDENS or $ELPOT group, or both. ... Similarly, if $ELDENS group is provided with IEDEN = 1, MORB = 0 and the $CUBE group is provided with cube=.t., then a 3D "cube" of total density data will be punched. ... PC GAMESS v. 6.1 specific documentation . ...

Еще в разделе: (Показать все результаты (>111) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - Density Functional Theory
• PC GAMESS/Firefly DOCUMENTATION - SMP, multicore and HTT features
• Lesson 3: two methods for preparing Firefly' input files with basis sets and

. [ Войти ] . Главная -> Фильмы -> Point Pleasant . Пользователи . Демо . Деньги . Фильмы . Форум . Point Pleasant . США 2005 . отметить . Сериал . Ужасы . Криминальный . Триллер . Драма . Мистика .

Еще в разделе: (Показать все результаты (>599) - kinfo.ru/ )

• Hollow Point - Фильмы - Kinfo.ru
• One Point O - Фильмы - Kinfo.ru
• Black Point - Фильмы - Kinfo.ru

... 2 Measurement of PMTs counting characteristics and selection of op erating p oint To select the operating point of the PMT, that is the optimal values of the high voltage supply and pulse discrimination threshold, the command run counting=hv value is provided in the program mass. ... Starting with the minimum voltage (say 550 V) run command run counting=550 for the measurement execution. ... It is recommended to take measurements for the set of values of 0.4, 0.6, 0.8, 1.0. ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

Faculty of Physics, Lomonosov Moscow State University Advanced Quantum Field Theory: Modern Applications in HEP, Astro & Cond-Mat Instructor: assist. prof., Dr. Oleg Kharlanov Term 2 Examination Syllabus (Fall 2014) 1. ... Self-consistent field approximation: the Hartree­Fock and Hartree­Fock­Roothaan equations; a qualitative analysis of the approximations used. ... Fundamentals of the Density functional theory: the energy functional, the Hohenberg­Kohn theorems, the universal functional F[n(x)] . ...

Еще в разделе: (Показать все результаты (>10) - theorphys.phys.msu.ru/ )

• http://theorphys.phys.msu.ru/education/aqft_slides/ExamSyllabus_Term1.pdf

... An Analysis of Modern Discrete Movements of the Earth's Crustal Blocks in Geodynamically Active Regions Based on GPS Data V. S. Zakharov and D. A. Simonov Moscow State University, Moscow, 119991 Russia e mail: zakharov@dynamo.geol.msu.ru; simon@geol.msu.ru Received March 24, 2009 Abstract--In this work original algorithms are proposed that allow us to provide a set of points (clusters) on a surface that are in cooperative motion, on the basis of an analysis of GPS data. ... Method O1. ...

Еще в разделе: (Показать все результаты (>24) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2011_2_eng.pdf
• http://dynamo.geol.msu.ru/personal/vsz/papers/Lubnina_etal_2015_eng.pdf

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ THE NEW GRIDDED KURIL-KAMCHATKA BATHYMETRY FOR TSUNAMI MODELING An. ... For calculations in each grid point where the depth is to be found the algorithm uses up to 9 points from data source. ... Then the spline interpolation is used for defining the depth value in the grid-point. ... Hydrographic Survey Data, CD-ROM data set, Ver. ...

Еще в разделе: (Показать все результаты (>19) - seac47-2.phys.msu.ru/ )