... All known experimental data about off-center impurities were related so far to small atoms which substitute for larger atoms in crystals. In this work we shall present the first direct observation of the off-centering of large Pb and Sn substitutional impurities in GeTe. ... The data were explained by the activation of unshared s 2 electron pair of Sn and Pb impurities in chemical bonding under the condition of high local stress induced by these impurities in GeTe lattice. ...

Еще в разделе: (Показать все результаты (>70) - scon155.phys.msu.su/ )

• Proceedings of the Fifth Russian-Japanese Symposium on Ferroelectricity
• Program of the 5th Russian-Japanese Symposium on Ferroelectricity (Moscow,
• Ормонт Михаил Александрович

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>2) - mouse.genebee.msu.ru/ )

... Большая часть материала была собрана на Звенигородской биостанции (ЗБС) МГУ на мухоловке-пеструшке ( Ficedula hypoleuca ) . ... С. 31-32. [скачать pdf-файл] . ... С. 278-295. [скачать pdf-файл] . ... Bushuev A.V., Ivankina E.V., Kerimov A.B, 2003. Factors influencing resting metabolic rate of Pied Flycatcher fledglings (Ficedula hypoleuca Pallas) // Vogelwarte (Abstract Volume 4 th Conference of the European Ornithologists' Union. ... Bushuev A.V., Ivankina E.V., Kerimov A.B., 2006. ...

Еще в разделе: (Показать все результаты (>58) - vertebrata.bio.msu.ru/ )

Verwaltung f?r Berufsberatung und Betreuung talentierter Jugend . ... Die neueste Ausgabe der Kinderzeitung des Unionsstaates Russland und Weissrussland ?Druzja ? ... vom 23. bis zum 27. Juni 2015 an der MSU . ... Das Thema der Konferenz: ?Geographie, Kultur und Gesellschaft der Erde in der Zukunft? ... Organisatoren der Konferenz: Moskauer Staatliche Lomonossow-Universit?t, Russische Gesellschaft f?r Geographie und Geographisches Institut der Russischen Akademie der Wissenschaften. ...

Еще в разделе: (Показать все результаты (>38) - talant.msu.ru/ )

• admin | The Department of Talented Youth Affairs and Professional Orientation |
• Die neueste Ausgabe der Kinderzeitung des Unionsstaates Russland und
• XVIII. Fulbright-Sommerschule ?Grosse B?cher und Schulen des kritischen Lesens?

Charge and mass transfer across the metal -solution interface E. Gileadi School of Chemistry Tel-Aviv University, ISRAEL gileadi@post.tau.ac.il 1 Time-Resolved Kinetics · The idea of different time scales for electron transfer and solvent reorganization is inherent in the Marcus theory · The characteristic time for different processes is: Electron transfer Solvent reorganization 1 fs 1 ps (103 fs) Diffusion across the ... Ag + soln +e crys Ag 0 soln E0 = - 2.55 V vs. ...

Еще в разделе: (Показать все результаты (>58) - electr003.chem.msu.ru/ )

• In memory of Sasha Kuznetsov
• Liana N. Sviridova:CV
• Elena V. Stenina:CV

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . General Discussion >> Common >> Walking around GZ . ... Maxus . ... Рейтинг: 1204 . Walking around GZ [ re: Maxus ] . ... Рейтинг: 0 . ... Re: Walking around GZ [ re: screw ] . ...

Еще в разделе: (Показать все результаты (>2111) - www.snto-msu.net/ )

• Love Actually - Christmas is All Around - Public forum of MSU united student
• dancing around the world - Public forum of MSU united student networks
• Billy Mack - Christmas is All Around - Public forum of MSU united student

... International meeting . Toric Topology 2014 in Osaka . ... 21-24 January 2014 . ... a satellite conference of ICM 2014 , Seoul . ... 7-11 August 2014 . ICM 2014 Satellite Conference on Algebraic Topology . ... International Conference . ... Group Action Forum . ... Tsinghua Sanya International Mathematics Forum, China . ... Topology ATLAS: Conferences and Seminars . British Topology conference list (maintained by Sarah Whitehouse) . Group Action Forum (GAF) conference page . ...

Еще в разделе: (Показать все результаты (>92) - higeom.math.msu.su/ )

• INVITED ADDRESSES:
• Toric Topology (English)
• Topology section

Supernova 2000de in NGC 4384 . This page is devoted to information on Supernova 2000de in NGC 4384 Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the Supernova links web page. Marco Migliardi of CROSS discovered this one. He first sent it out as a "possible" to the ISN group on August 12.8. ... CROSS 2000de page . ... CROSS image . ...

Еще в разделе: (Показать все результаты (>78) - www.rochesterastronomy.org/ )

• Supernova 1999gn in M61
• Supernova 1987A in LMC
• Supernova 1998ab in NGC 4704

This module provides an environment variable with a unique identifier for each request. ... The unique identifier is even unique across multiple machines in a properly configured cluster of machines. ... On Unix machines, Apache creates several children, the children process requests one at a time. ... To distinguish time we will use a Unix timestamp (seconds since January 1, 1970 UTC), and a 16-bit counter. ... The actual ordering of the encoding is: time stamp, IP address, pid, counter. ...

Еще в разделе: (Показать все результаты (>73) - neptun.sai.msu.ru/ )

• Apache Keep-Alive Support
• Environment Variables in Apache
• Descriptors and Apache

... Electromagnetic nature of light precursors of earthquakes / Natyaganov V.L. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>31) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Editorial
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 2/2013

... Site is discontinually updating by professional biologists and students of biology faculty of MSU. ... All Journals . This list contains all journals in JCatalog database. Select the letter and click it. If there is no action when clicking then no journals begins from this letter. Set the mouse cursor on any letter and you will know the number of journals; gray letter colour means that no journals begins from it. ... View whole journal list(1749) . ... Index | All journals . ...

Еще в разделе: (Показать все результаты (>28) - journals.genebee.msu.ru/ )

• Different alphabetic indexes of JCatalog
• JCatalog >> Journal information >>

... Surface tension and dynamic contact angle analysis for liquid droplets . ... 8th Pacific Symposium on Flow Visualization and Image Processing . ... The methods of the surface tension measurement using the pendant or sessile drop profile are well known for their reliability and universality. The method procedures are well established but still require high quality drop images to measure the surface tension automatically, what may be the problem in difficult experimental conditions. ...

Еще в разделе: (Показать все результаты (>157) - imaging.cmc.msu.ru/ )

. Coordinates . Charged particles flux . Ultraviolet radiation . The periods of high geomagnetic activity in 2005. 10 MeV, the data from the NOAA series satellites) . January 20-26 . May 5-20 ( data is available ) . June 16-19 . July 13-21 ( data is available ) . July 26 - August 6 . August 22 - September 3 ( data is available ) . September 7-20 ( data is available ) . Charged particles flux measured by Coronas-F satellite

Еще в разделе: (Показать все результаты (>33) - cosmos.msu.ru/ )

. Print . Details . Written by Ольга Жулябина . Published: 30 November -0001 . Meeting with the delegation from Mitsubishi Electric took place on August 22 2014. Engineering physics laboratory wants to make investigations withљ Mitsubishi Electric.љ Mitsubishi Electric delegation visited our laboratory on August 22 2014. Collaboratores showed main projects of our laboratory. During the meeting students' education and practical training were also discussed.

Еще в разделе: (Показать все результаты (>12) - engineering.phys.msu.ru/ )

• Participation in INNOPROM-2015
• Participation in IX Science Festival

Environmental summer camp in Estonia 3-11 August . ... camp and a case study "The potentials and limits of sustainable development . in Otepфф Nature Park, Estonia". ... Costs: All costs in Estonia will be covered (accommodation, food, local . ... your own bike with you. ... natural values of the landscape of Otepфф municipality in Estonia. ... part of Estonia in a peripheral area. ... The nature surrounding Otepфф is a . ... small area local government, private economic enterprises and Otepфф . ...

Еще в разделе: (Показать все результаты (>9) - www.ecocoop.ru/ )

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>9) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30 љ љљ 736 - 1.ГУМ . ... Морозова Е.Б. пн. љ17-00? 18-30, 18-45?20-15, 20-30?21-15љ 1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг љ15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>168) - www.genebee.msu.ru/ )

• GeneBee
• Screening protein sequence against PROSITE databank
• Notes on searching by similarity

The Theft of the Millenium. Review on a Review . ... I also have been supporting for seven years a web page and discussion board on these topics which evolved from my investigation of outrageous theory on world history of Russian mathematician Anatoly Fomenko hbar.phys.msu.ru/gorm/fomenko.htm . ... classical eclipses of Thucydides) . ... This gives us possibly total eclipse in Rome approximately 31 years after the first eclipse of Thucydides (beginning of the second year of 87th Olympiad). ...

Еще в разделе: (Показать все результаты (>92) - hbar.phys.msu.ru/ )

• R.R.Newton, "Astronomical evidence..."
• Autobiography of Joseph Scaliger
• R. R. Newton, "Two uses of ancient astronomy"

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>163) - www.pereplet.ru/ )