. Download freeware version for VES and VES-IP interpetation - IPI- v7.6 Lite (425Kb, Dos, up to 7 VES points in profile) . VES curve interpretation . Cross-sections . Induced polarization curve interpretation .

Еще в разделе: (Показать все результаты (>56) - geophys.geol.msu.ru/ )

• Anis. Page2
• IPI2win - 1D interpretation of VES profile.
• IPI_MTS - interpretation mode.

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

. Print . Details . Written by Ольга Жулябина . Published: 30 November -0001 . Meeting with the delegation from Mitsubishi Electric took place on August 22 2014. Engineering physics laboratory wants to make investigations withљ Mitsubishi Electric.љ Mitsubishi Electric delegation visited our laboratory on August 22 2014. Collaboratores showed main projects of our laboratory. During the meeting students' education and practical training were also discussed.

Еще в разделе: (Показать все результаты (>12) - engineering.phys.msu.ru/ )

• Participation in INNOPROM-2015
• Participation in IX Science Festival

Geomagnetic Storm Summary for October 24-November 5, 2003 . ... UPDATED October 30, 2003 . October 30, 2003 . ... March 18, 2003 . August 16, 2002 . ... April 22, 2002 . ... November 5, 2001 . October 26, 2001 . ... April 27, 2001 . ... March 29, 2001 . ... March 13, 1989 North American View 7:42UT . March 13, 1989 North American View 21:40UT . March 13, 1989 Atlantic View 21:40UT . April 6, 2000 North American View 23:15UT . July 15, 2000 North American View 20:10UT . ...

Еще в разделе: (Показать все результаты (>106) - www.kosmofizika.ru/ )

• L.Lazutin, List of publications
• Л.Л. Лазутин, Публикации
• X-RAY, GAMMA-RAY EMISSION AND HIGH-ENERGY CHARGED PARTICLES IN NEAR-EARTH-

. Coordinates . Charged particles flux . Ultraviolet radiation . The periods of high geomagnetic activity in 2005. 10 MeV, the data from the NOAA series satellites) . January 20-26 . May 5-20 ( data is available ) . June 16-19 . July 13-21 ( data is available ) . July 26 - August 6 . August 22 - September 3 ( data is available ) . September 7-20 ( data is available ) . Charged particles flux measured by Coronas-F satellite

Еще в разделе: (Показать все результаты (>42) - cosmos.msu.ru/ )

... My host university was Stanford University in California. ... Some of my impressions about the United States and the people of that country are in it, and I thought some pages from my diary would be interesting for you. ... Today the orientation is over. ... Soon I will be in Palo Alto. ... It was the one big problem. ... A few days before I had been in despair. ... I have a room on the first floor. ... Today we (Carol and I) attended a divine service at St. Mark's Episcopal Church in Palo Alto. ...

Еще в разделе: (Показать все результаты (>84) - www.prof.msu.ru/ )

• THE ROLE OF ISLAM IN THE POST-SOVIET CENTRAL ASIA
• Internationalizing Education In Barnaul State Pedagogical University
• INTERNATIONAL FULBRIGHT SCIENCE AND TECHNOLOGY AWARDS

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>10) - imaging.cs.msu.ru/ )

PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) unpack -- Unpack data from binary string . array unpack ( string format, string data) . unpack() from binary string into array according to format . Returns array containing unpacked elements of binary string. unpack() works slightly different from Perl as the unpacked data is stored in an associative array. To accomplish this you have to name the different format codes and separate them by a slash /. ...

Еще в разделе: (Показать все результаты (>194) - oit.cmc.msu.ru/ )

• CURL, Client URL Library Functions
• Unix/Mac OS X installs
• Unix/Linux installs

Environmental summer camp in Estonia 3-11 August . ... camp and a case study "The potentials and limits of sustainable development . in Otepфф Nature Park, Estonia". ... Costs: All costs in Estonia will be covered (accommodation, food, local . ... your own bike with you. ... natural values of the landscape of Otepфф municipality in Estonia. ... part of Estonia in a peripheral area. ... The nature surrounding Otepфф is a . ... small area local government, private economic enterprises and Otepфф . ...

Еще в разделе: (Показать все результаты (>10) - www.ecocoop.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>123) - www.genebee.msu.ru/ )

• Screening protein sequence against PROSITE databank
• Notes on searching by similarity
• AliGraf - GeneBee Graphical Alignment Help

... Geology and geochemistry of ore deposits . ... The Head of the Chair, Professor N.V.Koronovsky The Chair trains students in two areas of specialization: (1) Geotectonics and (2) Geological Survey and Prospecting of Mineral Deposits. ... Members of the Chair give lectures on General Geology to students not only of the Faculty of Geology but also those of the Faculty of Geography and the Faculty of Soil Science. They provide students with field training in the Crimea and Moscow region. ...

Еще в разделе: (Показать все результаты (>53) - www.geol.msu.ru/ )

• IPI2win - 1D interpretation of VES profile.
• Faculty of Geology >> Geology at Moscow State University

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30 љ љљ 736 - 1.ГУМ . ... Морозова Е.Б. пн. љ17-00? 18-30, 18-45?20-15, 20-30?21-15љ 1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг љ15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

... Medium (solvent) coordinates 3. Quantum effect of solvent on activation barrier 4. ... sucrose solutions: C D ( w) = + + 1 + (iw C ) 1 + iw water-EG mixtures: D 3 1 2 ( ) = + + + 1 + i 2 1 1 + i 2 2 1 + i 2 3 series N solvent modes Solvent reorganization energy (exact expansion ) correlation times K ( ) = 2k BT Solvent correlation function i =1 N i exp (- / ) * i i =1 N i = 1 i is the contribution of i-th mode to the solvent reorganization energy The solvent reorganization ...

Еще в разделе: (Показать все результаты (>14) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/malev.pdf
• Molecular aspects of solid state and interfacial electrochemistry

DESCRIPTION OF THE 3d SOLAR EVENT MAP . ... This date coincides with central day of the map marked by solid vertical line (in the present example - 13 July, 2000). ... The following phenomena are presented on the map: coronal holes, filaments, solar flares and the distribution of the solar magnetic field on the source surface (2.5 solar radii). The coronal holes are drawn by irregular solid curves with colors according to the day of observation (light blue, orange and violet). ...

Еще в разделе: (Показать все результаты (>16) - dbserv.sinp.msu.ru/ )

• 1d Map Description

... High Brightness RTM . ... Techniques to generate short, small emittance electron bunches of several nC at energies of several MeV are being developed to drive free electron lasers, for accelerator research, to provide short laser Thomson scattering X-ray pulses, and to generate intense coherent millimeter radiation (e.g., synchrotron, transition, etc.) ... Generating several tens of MeV beams now requires large, expensive, energy inefficient accelerators available only at large laboratories. ...

Еще в разделе: (Показать все результаты (>4) - vserv.sinp.msu.ru/ )

... Linguistic expeditions . ... The expeditions worked in different villages with Selkup, Ket, Evenki, and Forest Nenets population of the Pur and Krasnoselkup districts of the Yamalo-Nenets autonomous area, and of the Turukhansk and Evenki districts of the Krasnoyarsk Territory. The expeditions were supported by Russian Foundation for Basic Researches and Russian Foundation for the Humanities. ... Students of Russian State University for the Humanities took part in the expedition. ...

Еще в разделе: (Показать все результаты (>29) - lcl.srcc.msu.ru/ )

... Trac has a built-in functionality for visualizing тАЬdiffsтАЭ - changes to files. ... Line numbers on the left side indicate the exact position of the change in both the old and the new version of the file. ... When viewing a repository check-in, such as when following a changeset link or a changeset event in the timeline , Trac will display the exact changes made by the check-in. ... The last possibility for examining changes is to use the Last Change link provided by the TracBrowser . ...

Еще в разделе: (Показать все результаты (>359) - kodomo.cmm.msu.ru/ )

• Department of animal cell biochemistry - Staff and contacts
• TracStandalone тАУ Tanchiki
• WikiProcessors тАУ Tanchiki

Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>4) - swx.sinp.msu.ru/ )

. To view the high resolutiuon photos press the images. Attention! The size of each photo is from 1.5 to 2.5 MBytes. Home page

Еще в разделе: (Показать все результаты (>28) - rswater.phys.msu.ru/ )

• Laboratory of laser spectroscopy of solutions of supramolecular compounds and
• Alexey Vervald
• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и

XIII International Meeting of the International Humic Substances Society Castle Technical University July 31 to August 4, 2006 , Karlsruhe Campus XIII International Meeting of the International Humic Substances Society XIII International Meeting of the International Humic Substances Society Humic ...