... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . ... GML BOLT v. 1.1 November 11, 2009 Download . ... Balanced On-line Learning Toolkit is an open-source library that contains a set of on-line classifier interfaces and their implementations. ... Some of toolbox classifiers can also efficiently learn from class-unbalanced streams. ... IClassifier -- the interface for a learned classifier that has been introduced in A.Vezhnevets' GML AdaBoost Toolbox . ...

Еще в разделе: (Показать все результаты (>142) - graphics.cs.msu.ru/ )

• Online Random Forest for Interactive Image Segmentation | Graphics and Media...
• GML Balanced On-line Learning Toolkit | Graphics and Media Lab
• Online Random Forest for Interactive Image Segmentation | Лаборатория

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>15) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.

... For instance, approximately 90% and 40% of genes in primate genomes contain at least one intron with length more than 1 kbp and 10 kbp, respectively. The existence of extremely long introns have been of interest for a long time and different studies about intron length have been done. ... Average intron length, bp Number of intron groups 7 7 7 6 5 2 400-1000 1000-2000 2000-4000 4000-8000 8000 16000 over 50000 We have compared the phases and lengths of the aligned introns. ...

Еще в разделе: (Показать все результаты (>290) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/155.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/13.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/115.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>167) - www.genebee.msu.ru/ )

• Laboratory of protein-nucleic interactions (Russian version)

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>5) - npidb.belozersky.msu.ru/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... We plan to create a multi-channel analyzer through a detector which comprises a semiconductor in addition to the selective line of resistive type sensors , the sampling system also allowing to carry out a catalytic conversion and concentration of target gases. ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>41) - www.lssm.inorg.chem.msu.ru/ )

Optical imaging of fluorescent carbon biomarkers using artificial neural networks Tatiana A. Dolenko Sergey A. Burikov Alexey M. Vervald Igor I. Vlasov Sergey A. Dolenko Kirill A. Laptinskiy Jessica M. Rosenholm Olga A. Shenderova Downloaded From: http://biomedicaloptics.spiedigitallibrary.org/ on 12/17/ 2014 Terms of Use: http://spiedl.org/terms Journal of Biomedical Optics 19(11), 117007 (November 2014 ) Optical imaging of fluorescent ... Results of Using Artificial Neural Networks Fig. ...

Еще в разделе: (Показать все результаты (>31) - rswater.phys.msu.ru/ )

• Laboratory of laser spectroscopy of solutions of supramolecular compounds and
• Group of laser spectroscopy of solutions of supramolecular compounds and

Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>11) - swx.sinp.msu.ru/ )

... MBA . EXECUTIVE MBA . ... Международные связи . ... Международная конференция в Риге 'Define Europe - Different Sculptors, One shape' . ... В конференции примут участие представители различных международных организаций: . ... Янис Биркс (Janis Birks) - Мэр г. Рига и др. ... Конференция будет проходить в Риге, Латвия с 8 по 11 Октября 2009 года. ... Executive MBA . ... Членство в международных образовательных ассоциациях и альянсах . ...

Еще в разделе: (Показать все результаты (>118) - www.mgubs.ru/ )

• Высшее образование | Высшая школа бизнеса МГУ им. Ломоносова

Vol 444|30 November 2006 NEWS & VIEWS ARCHAEOLOGY High tech from Ancient Greece FranГois Charette The Antikythera Mechanism, salvaged 100 years ago from an ancient shipwreck, was long known to be some sort of mechanical calendar. ... LIBRARY, LEIDEN STEM-CELL BIOLOGY A move in the right direction Jeffrey S. Chamberlain Stem-cell therapy is valued for its potential to restore damaged or degenerating tissues. ... Although a variety of stem-cell types can become muscle cells when injected into the ...

Еще в разделе: (Показать все результаты (>132) - hbar.phys.msu.ru/ )

• R. R. Newton, "Two uses of ancient astronomy"
• Dionysius Petavius
• R.R.Newton, "Astronomical evidence..."

Volume 163, number 2 FEBS 0973 November 1983 Diazepam inhibits cell respiration and induces fragmentation of mitochondrial reticulum Ivan A. Vorobjev and Dmitry B. Zorov A.N. Belozersky Laboratory of Molecular Biology and Bioorganic Chemistry, Moscow State University, 117234 Moscow, USSR Received 1 August 1983; revised version received 14 September 1983 Diazepam (70-150 µg/ml) significantly inhibits oxygen consumption by pig kidney embryo cells and causes the cellular ATP level to fall. ...

Еще в разделе: (Показать все результаты (>36) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/Alieva04.pdf
• http://cellmotility.genebee.msu.ru/html/articles/vorobjev83-1.pdf
• http://cellmotility.genebee.msu.ru/html/articles/alieva97.pdf

THE ROLE OF COMPUTER IN TEACHING-LERNING PROCESS Beldiga-Vasilache M.Gh., ... According to a study, students who use computer for learning at home, achieved higher scores than other children, is because lessons at the coputer complets teacher explanations with multimedia elements and virtual experiments. ... Computer training is the way in which the interaction of teaching and learning, between teacher and students, is the means of this computer. ...

Еще в разделе: (Показать все результаты (>199) - www.mce.biophys.msu.ru/ )

• Heat transfer in non-uniform by structure monodisperse system, containing

... According to the EXAFS data, in the single-phase sample of SrTi0:97 Ni0:03 O3, the Ni atoms substitute for the Ti ones and are oncenter. ... Color online) XANES spectra for SrTiO3(Ni) samples and nickel reference compounds: (1) SrTi0:97 Ni0:03 O3 sample annealed at 1500 C, (2) SrTi0:97 Ni0:03 O3 sample annealed at 1100 C, (3) Sr0:98 Ni0:02 TiO3 sample annealed at 1500 C, (4) Sr0:98 Ni0:02 TiO3 sample annealed at 1100 C, (5) BaNiO3ю , (6) NiTiO3 and (7) NiO. ...

Еще в разделе: (Показать все результаты (>100) - scon155.phys.msu.su/ )

• Influence of random fields on the ferroelectric phase transition in IV-VI
• First-principles calculations of physical properties of crystals
• New arguments in support of the off-center positions of the tin atoms in

... November, 2005 . ... Moscow State University Russian Language Centre . ... Learn Russian at the Moscow State University! On November, 18th at Session of Advice of academic councils of the Moscow State University by ballot by the rector on the following five years have been selected Victor Antonovich Sadovnichy. (more.. ... Cinema lovers from across France and beyond are converging on the sea resort of Honfleur in Normandy to get a glimpse of contemporary Russian cinema (more.. ...

Еще в разделе: (Показать все результаты (>9) - www.rlcentre.com/ )

JOURNAL OF APPLIED PHYSICS 113, 17A946 (2013) Magnetoplasmonic crystals based on commercial digital discs A. A. Grunin,a) A. V. Chetver tukhin, T. V. Dolgova, A. A. Ezhov, and A. A. Fedyaninb) Faculty ... Russia (Presented 17 January 2013; received 5 November 2012; accepted 22 February 2013; published online 15 April 2013) Transversal magneto-optical Kerr effect ( TKE ) controlled by surface plasmon-polariton resonances is studied in nickel and combined ... The TKE value was defined as d ? ...

Еще в разделе: (Показать все результаты (>67) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/jap113_17a942_2013.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jetplett103_46_2016.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jmmm2016_1.pdf

... Python . ... О UNИX . ... ApacheOnWin32 . ... C:\Apache . ... Choose a location appropriate for you; the following instructions assume you will be creating one or more wiki instances in C:\Moin\ and the first wiki instance will be named mywiki . ... This will create a clone of the MoinMoin wiki in the mywiki folder. cd C:\ md Moin md Moin\mywiki md Moin\mywiki\data md Moin\mywiki\underlay cd \Python\share\moin xcopy data C:\Moin\mywiki\data /E xcopy underlay C:\Moin\mywiki\underlay /E copy config\*....

Еще в разделе: (Показать все результаты (>134) - uneex.mithril.cs.msu.su/ )

• HelpOnLists - UNИX
• HelpOnComments - UNИX
• HelpOnSearching - UNИX

The Department of Talented Youth Affairs and Professional Orientation . ... Olympiads . ... All-army olimpiad . ... Olympiad for School Pupils . ... Olympiad for school pupils was held in 2005 under the motto ?Via scientiarum?, which means ?The way to the knowledge? in Latin. ... The 46 th Mendeleev International Olympiad in Chemistry for School Pupils was held in Kazakhstan in the 2011-2012 school year. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>43) - talant.msu.ru/ )

• News | The Department of Talented Youth Affairs and Professional Orientation |
• Moscow CTF School 2015 competitions in Information Security for schoolchildren
• MSU will hold International Universiade in Biology | The Department of Talented

To see a Russian version of this page, click here . ... Bochkarev Nikolai Gennadievich . astrophysics researcher: . born: Moscow, May 19, 1947; . ... Jr. researcher Sternberg Astronomical Inst., ... Soviet (Russian) Working Group on Interstellar Matter, Moscow , 1979-; . ... Madison, 1991. ... ALocal Interstellar Matter, 1990, . Basic Physics of the Interstellar Matter, 1992; co-author: . ... Physics of Interstellar Matter, 1979; . ... All-Union Astronom. Geodesical Soc., ... Astronom. ...

Еще в разделе: (Показать все результаты (>12) - uranus.sai.msu.ru/ )

• Tatjana Khruzina
• The Database of Close Binary Systems

... Sunday, November 4, 2007 |4:30 - 6:30pm |Flight SU #303 arrives to |Pickup at Pearson Int'l Airport | ... 8:00 - 10:00pm |Dinner |Executive Dining Room | Monday, November 5, 2007 |7:00 - 9:00am |Breakfast |Executive Dining Room | ... Tuesday, November 6, 2007 |7:00 - 8:00am |Breakfast |Executive Dining Room | ... 12:30 - 1:30pm | ... Wednesday, November 7, 2007|7:00 - 9:00am |Breakfast |Executive Dining Room | ... Thursday, November 8, 2007 |7:00 - 9:00am |Breakfast |Executive Dining Room | ...

Еще в разделе: (Показать все результаты (>2) - www.innovation.msu.ru/ )

... Version history . ... Fortran-DVM and C-DVM languages supported data distribution by equal blocks and corresponding distribution of parallel loop iterations (data parallelism). ... A new toolkit - DVM-program performance analyzer was included in the version. ... Fortran-DVM and C-DVM languages support now data distribution by non-equal blocks and parallel executed program section specification (task parallelism). ... The version 3.30 (27.12.2000) is differ from version 3.15 in the following: . ...

Еще в разделе: (Показать все результаты (>98) - sp.cs.msu.ru/ )

• Lib-DVM. Preliminary design
• Prefictor of DVM-program performance. User's guide
• DVM-system. Goals and structure