... Faculty of Soil Science, Moscow State University . ... Evaluation of acid deposition effects on soils as a component of forest ecosystems. ... Estimation and prediction of forest soil response to acid deposition with simple process-based models. ... Forest soil response to acid deposition, in particular the significance of soil organic matter in the processes of proton consumption, sulphur retention, aluminium and heavy metals mobilisation was investigated. ... Acid Deposition and Forest Soils. ...

Еще в разделе: (Показать все результаты (>19) - eco.soil.msu.ru/ )

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30 љ љљ 736 - 1.ГУМ . ... Морозова Е.Б. пн. љ17-00? 18-30, 18-45?20-15, 20-30?21-15љ 1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг љ15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

APPLICATION OF THE DIFFRACTION RADIATION INTERFEROGRAM OBTAINED AFTER THE INTERACTION OF AN ELECTRON BEAM WITH A SLIT TARGET D.A. Shkitov1), G.A. Naumenko1), M.V. Shevelev1), A.P. Potylitsyn1), H. Deng2), X. Wang 1) TPU, Tomsk, Russia 2) SINAP, Shanghai, China 2) In October 2011 a joint Russian-Chinese experiment on the extracted beam of the microtron TPU was carried out. ... Calculation taking into account the source self atten uation effect, this approach is based on the direct mathematical method. ...

Еще в разделе: (Показать все результаты (>104) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LAS/Nimb254_jan07_200Shulga.pdf

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>22) - foroff.phys.msu.ru/ )

• Useful Information
• Глубокоуважаемые коллеги

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>8) - mouse.belozersky.msu.ru/ )

• wLake program homepage

... Hyper-Rayleigh scattering in nongomogeneous thin films and interfaces . ... N.V. Didenko , B.P. Antonyuk, N.N. Novikova, and O.A. Aktsipetrov , Light-induced c -nonlinear susceptibility and its 1/ w fluctuations in silica glasses, Phys. Lett. ... N.V. Didenko , A.A. Fedyanin, E.P. Lukashev, and O.A. Aktsipetrov, Nonlinear interferometry of second-harmonic generation and hyper-rayleigh scattering from thin inhomogeneous films, IQEC ’98 [San Francisco, USA, 1998, Technical Digest, p. 111-112]. ...

Еще в разделе: (Показать все результаты (>25) - shg.phys.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>128) - www.genebee.msu.ru/ )

• GeneBee
• LMI abstracts

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>20) - site2010.sai.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>15) - www.chemport.ru/ )

• Real estate market monitoring september 2011 3 дрсу база данных землевладельцев

Title Authors Key words On the issue of modern Russian society's consolidation Samsonova T.N., Shpuga E.S. Russia, consolidation, social inequality, corruption, national security, president, trust, national idea The authors analyze the problems that challenge to consolidation of contemporary Russian society, such as social inequality in different spheres, high level of corruption, the inefficiency of public authorities, demographic problems etc., and trace major consolidation trends. Abstract

Еще в разделе: (Показать все результаты (>135) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/13.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2014/3/03.pdf
• http://www.socio.msu.ru/documents/umo/bologne/Magna%20Charta%20Universitatum.pdf

... Research . ... Our group was established in September, 2006, by members of Laboratory of Nonlinear Optics of Nanostructures and Photonic Crystals (Dr. A.A. Fedyanin and Dr. T.V. Dolgova) and of Laboratory of Scanning Probe Microscopy (Dr. A.A. Ezhov) for development of new directions at the Department of Quantum Electronics, Faculty of Physics. Main activities of the group relate to the nanophotonics and nano-optics of different types of nanostructures including metamaterials. ...

Еще в разделе: (Показать все результаты (>82) - nanolab.phys.msu.ru/ )

• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &
• Nanophotonics of surface states in photonic crystals | Laboratory of
• About the laboratory | Лаборатория нанооптики и метаматериалов

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Web Sites . ... General Information . ... Most programs at the Moscow State University are taught in Russian. ... passing Russian State Exam (ЕГЭ), following the general rules on http://cpk.msu.ru ), . ... Lomonosov Moscow State University Institute of Russian Language and Culture . ... Lomonosov Moscow State University . ... Copyright 1997?2016 Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>68) - www.msu.ru/ )

• Alexander Vladimirovich SIDOROVICH - Pro-Rector
• International Summer Schools at Lomonosov Moscow State University
• Further Education Programs at MSU

О лаборатории . ... Лаборатория теоретической биофизики . ... ERG group members work with different types of molecules and consequently added new atomtypes into classical OPLS-AA distributed with GROMACS. Now the ERG patch of OPLS-AA force field is published at bitbucket as a repository. ... Нет комментариев " OPLS-AA patch for different types of molecules " . ... OPLS-AA patch for different types of molecules . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2016 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>57) - erg.biophys.msu.ru/ )

• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• OPLS ERG Research Group: Лаборатория теоретической биофизики
• topology ERG Research Group: Лаборатория теоретической биофизики

... Seminar archive . ... Бескин В. С. В последнее время заметно снизилось количество работ, посвященных классическим проблемам пульсаров -- теории магниосфер радиопульсаров и теории происхождения пульсарного радиоизлучения. ... In the last years the number of papers devoted to classical problems - theory of the magnetosphere of radio pulsars and theory of their coherent radio emission - decreased abraptly. ... I'm going to review the last theoretical works on radio pulsars. physics. All seminars: . ...

Еще в разделе: (Показать все результаты (>35) - master.sai.msu.ru/ )

The topic of a student research: Patterns recognition of Supersecondary structures Abstract The goal of this project to prove the hypothesis that proteins with identical supersecondary structure have common sequence patterns even if they belong to different protein families and have very low sequence similarities. ... Application of usually used methods of sequence alignment to find the conserved positions is not available here because of very low sequence similarity (less than 10%). ...

Еще в разделе: (Показать все результаты (>3856) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/FBB/year_05/term4/KEGG.pdf

Research topics . ... This group is formed to study the reactions at semiconductor surfaces. ... Group members: . ... M.V. Lomonosov Moscow State University: . ... Dr. Tatiana S. Zyubina, senior scientific researcher (quantum chemical modeling) . ... Joint Semiconductors Surface Study group: research sketches . The Joint Semiconductors Surface Study (JSSS) group was developed on the base of Inorganic Chemistry division, Chemistry dept. of M.V. Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>42) - www.inorg.chem.msu.ru/ )

• Group of Hydrothermal Synthesis :: News

... In the meanwhile, Fred continued development, going on to Net-2e, which features a much revised design of the networking layer. ... Most notable about Net-2e is the incorporation of DDI, the Device Driver Interface . ... For this, he integrated some of the BSD networking code in the kernel. ... This only applies to commands that deal with kernel internals rather closely; applications and common networking commands such as rlogin or telnet run on either of them. ...

Еще в разделе: (Показать все результаты (>335) - itpm.msu.su/ )

• How filters work in Apache 2.0 - Apache HTTP Server
• Multi-Processing Modules (MPMs) - Apache HTTP Server
• Overview of the Directory Tree

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>27) - rswater.phys.msu.ru/ )

• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и
• Photo report: Participation in 21st Colloquium on High Resolution Molecular
• Group of laser spectroscopy of solutions of supramolecular compounds and

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>77) - neptun.sai.msu.ru/ )

• How Directory, Location and Files sections work
• Environment Variables in Apache
• International Customized Server Error Messages

PHP Manual . ... PHP 4 ) read_exif_data -- Read the EXIF headers from a JPEG . array read_exif_data ( string filename) . The read_exif_data() function reads the EXIF headers from a JPEG image file. ... Exif headers tend to be present in JPEG images generated by digital cameras, but unfortunately each digital camera maker has a different idea of how to actually tag their images, so you can't always rely on a specific Exif header being present. Example 1. read_exif_data . ...

Еще в разделе: (Показать все результаты (>323) - oit.cmc.msu.ru/ )

• xslt_set_log
• Using PHP from the command line
• switch