sp|P69618|SHDAG_HDV83 Small delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFP sp|P25989|SHDAG_HDVAM Small delta ...

Еще в разделе: (Показать все результаты (>1096) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~a_anisenko/term2/text/delta_aligned.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/deltaaligned.fasta

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>12) - comphep.sinp.msu.ru/ )

Computing polygon as a research tool in studying hardware-software platforms" . A.S. Antonov and B.Yu. ... The Computing polygon installed at the Research Computing Center of Moscow University provides operative access by Internet to computing resources to perform small preliminary experiments and to choose an appropriate hardware-software platform. ... In this paper, various clusters of the polygon are compared on the basis of special test problems. PostScript (in Russian) (1.33MB) . ...

Еще в разделе: (Показать все результаты (>159) - num-meth.srcc.msu.ru/ )

• "The 3D-computer cluster simulation of forming the large-sized one-piece
• "Fault tolerance of small-world regular and stochastic interconnection...
• "A small-mode approximation in the stellar dynamo problem"

... Consider the Virtual Brewery, a small company that brews, as the name indicates, virtual beer. To manage their business more efficiently, the virtual brewers want to network their computers, which all happen to be PCs running a bright and shiny 1.0. ... They run an Ethernet of their own. Quite naturally, the two companies want to link their networks once they are operational. As a first step, they want to set up a gateway host that forwards datagrams between the two subnets. ...

Еще в разделе: (Показать все результаты (>177) - itpm.msu.su/ )

• CD-ROM's
• Subnetworks
• The root filesystem

University Satellites and . Space Science Education . General information Date and Location Objectives of the meeting Sponsoring Organizations International Advisory Committee Local Organizing Committee Deadlines Addresses Hotels & Accommodation Venue Visas Social Programme . First circular . Second circular . ... Abstract Submission List of submitted abstracts . ... The list of abstracts submited . Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6704) - cosmos.msu.ru/ )

• UNIVERSAT-2008: University Satellites in Space Sciences Education, Zvenigorod,

... Paper presented at the 10 th International Conference ?Cognitive modeling in Linguistics?. Montenegro, September 2008 [ ppt ]. ... Moscow, June 2008 [ ppt ]. (together with Ekaterina M. El?bert) Understanding spoken discourse: The contribution of three information channels Paper presented at the 3 rd International Conference on Cognitive Science. ... Invited talk presented at the seminar at the Research Computational Center, Moscow State University, June 2007 [ ppt ]. ... April 2001 [ ppt ]. ...

Еще в разделе: (Показать все результаты (>348) - www.philol.msu.ru/ )

• LangueDOC :: Publications
• LangueDOC :: Tofalar
• Teaching Staff

... Bohm limit DB=vrg/3: Emax Emax ush 0.3 Ze B Rsh c 1014(B/Bism) Z eV B Hillas criterion ! ... Voelk 2000; Kang Jones 2006) - Bohm diffusion in amplified magnetic field B2/8 = 0.035 u2/2 ( Voelk et al. 2005 empirical; Bell 2004 , Zirakashvili VP 2008 theoretical) - account for Alfvenic drift w = u + Va upstream and downstream - relative SNR rates: SN Ia : IIP : Ib/c : IIb = 0.32 : 0.44 : 0.22 : 0.02 Chevalier 2004 , Leaman 2008, Smart et al 2004, Berezinsky et al 2006 Das et al. ...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/horns_vhe.pdf

... 20.09.2009 . ... Moscow Vyatichi, November 9 - 11, 2009. ... In this work we study sum-frequency generation from the surface of an isotropic chiral medium in arbitrary interaction geometry of the paraxial light beams at fundamental frequencies. ... Within the first-order approximation approach, generally, the polarization state of light is distributed inhomogeneously in the reflected signal beam cross section, and the transversal intensity distribution is not Gaussian. ... Full publication text . ...

Еще в разделе: (Показать все результаты (>190) - ofvp.phys.msu.ru/ )

... Nonlinear fiber optics . ... member of the Editorial Board for the Laser Physics journal . ... Member of the steering committee of the international conference on Raman spectroscopy (ICORS): Budapest, 2002; Brisbane, 2004; Yokohama, 2006; London, 2008 . Member of the steering committee of the International Laser Physics workshop: Bratislava, 2002; Hamburg, 2003; Trieste, 2004; Kyoto, 2005; Lausanne, 2006; Leon, 2007; Trondheim, 2008; Barcelona, 2009 . ... International conference ?Laser Optics? ...

Еще в разделе: (Показать все результаты (>46) - photonicslab.phys.msu.ru/ )

• Nonlinear optics of ionized mediums

... О UNИX . ... Неизменяемая страница . ... Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать страницы ------------------------ ...

Еще в разделе: (Показать все результаты (>93) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_unix_base_admin/images
• PspoMaterials/AltDocs_install_sb - UNИX
• PspoMaterials/AltDocs_whatis_sb - UNИX

... Geography of World Economy . ... Belozerova E. Sediment fluxes in transboundary Selenga river basin // Proceedings of European Geosciences Union General Assembly in Vienna, Austria, 07 12 April 2013 . ... Nikolay Kasimov Sergey R. Chalov, M.Yu.Lychagin Hotspots within the Transboundary Selenga River Basin // Proceedings of European Geosciences Union General Assembly in Vienna, Austria, 07 12 April 2013 . ... Chalov S., Belozerova E., Nikolaev I. Water and sediment fluxes in Selenga river system. ...

Еще в разделе: (Показать все результаты (>49) - eng.geogr.msu.ru/ )

... Khmelev D.V. Reconstruction of linear index expressions for reducing programs to a linear class//Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki. ... Khmelev D.V. Limiting theorems for asymmetrical transportation networks//Fundamental and Applied mathematics, 2001, vol.7, no.4, pp. ... Khmelev D.V. Markov chains and classification of text passages. (in Russian) [Raspoznavaniye avtora teksta s ispol'zovaniyem cepei A.A. Markova] Vestnik MGU, Ser.9:Philologiya, No 2, 2000, pp. ...

Еще в разделе: (Показать все результаты (>55) - old.philol.msu.ru/ )

• Large transportation networks with finite-dimensional state space. Asimptotic
• Our publications

... 1920- . ... 1921 . ... 1925 . ... 1928 . ... 1928­1929 . 1929 . ... 1930 . ... 1933 . ... 1937 . ... 1920 1921 . ... 1929 , 1931 . ... 1934­1936 . 1932­1933. ... 28.09.1925­17.09.1926. ... 1925­1928. ... 1929­1930 . ... 1935) « » « » ( 1937). ... 1928­1970. ... 1930­1940. ... 1931­1934 .: ... 8 ­ () 1934. ... 1933­1934. ... 1934­1937. ... 1937­1962. ... 1968­1970. ... 1965­1970, 79 . ... 1925­1962 . ... 1970­1978. ... 1966­ 1970. ... 1920- 1960- . ... 1930­1970. ... 1970­1976. ... 1970. ...

Еще в разделе: (Показать все результаты (>66) - lcl.srcc.msu.ru/ )

• ЛАБОРАТОРИЯ АВТОМАТИЗИРОВАННЫХ

знания: Общая биология / Area of knowledge: Biology Наименование научного направления: Филогения и филогеография Name of since: Phylogeny and phylogeography Цель сотрудничества: Изучение систематики, филогенетики и филогеографии мелких млекопитающих Purpose of cooperation: Studies in systematics, phylogeny and phylogeography of small mammals Ссылки на публикации / Reference to publications: http :// vertebrata.bio.msu.ru / html /Bannikova_rus. html ...

Еще в разделе: (Показать все результаты (>73) - www.msu.ru/ )

• Information for applicants
• MSU Publications
• Scientific and scholarly publications in 2009

Organization and evolution of piRNA clusters in mosquitoes Phillip George, Chantal Vaury, Silke Jensen, Igor V. Sharakhov Entomology Department, Virginia Polytechnic Institute ... Development (GReD), University of Clermont-Ferrand, ClermontFerrand, France, chantal.vaury@udamail.fr The Piwi-interacting RNA ( piRNA ) pathway is an important mechanism in the defense against transposable element (TE) mobilization in many species including ...

Еще в разделе: (Показать все результаты (>151) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/243.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/129.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/5.pdf

... Bashindzhagyan G . ... Panasyuk M . ... Proc.26th ICRC, Salt Lake City , 1999, v.5, p.132-135. Bashindzhagyan G.L., Samsonov G.A., Khein L.A., Panasyuk M.I., . Voronin A.G., Zatsepin V.I., ATIC Collab .. The Advanced Thin Ionization Calorimeter (ATIC) for Studies of High . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.9-12. ... Silicon Matrix Detector for ATIC . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.453-456. ... Advanced Thin Ionization Calorimeter (ATIC) .- ...

Еще в разделе: (Показать все результаты (>26) - silab.sinp.msu.ru/ )

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Intracavity generation of broadband biphotons in a thin crystal?, Laser Physics Letters, 10 (4), 045203 (2013). ... Download [ help ]: . Download paper: doi page . ... Copyright notice: This material is presented to ensure timely dissemination of scholarly and technical work. ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>126) - qi.phys.msu.ru/ )

• Financial support :: Quantum Information Laboratory

... October 8, 15:00 15:40 . ... PDF [7.2б MB] October 8, 15:40 16:10 . ... The sky brightness, atmospheric extinction, cloud coverage and auroral appearance are obtained from these images. ... Aurorae are identified by comparing the observed sky brightness to the sky brightness expected from this model. ... The identification of few potential sites for future's larger facility require several instruments, measuring various site characterizing parameters. ...

Еще в разделе: (Показать все результаты (>18) - site2010.sai.msu.ru/ )

. Название публикации . Оpposite changes of rat hindlimb cutaneous and skeletal muscle small arteries contraction after 2-week tail suspension . Авторы . V.U. Kalenchuk, O.S. Tarasova, A.S. Borovik, O.L. Vinogradova . Дата . 31.12.2009 23:00:00 . Название журнала . J. Gravitational Physiology. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>5) - fbm.msu.ru/ )

... 6. 2 http :// lizard.phys.msu.su § лЁ (лElizavetЁ) : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , (3) ( SMALL C APS): , , , , , ; § л Ё (лElizavet NarrowЁ) : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , (3) ( SMALL CAPS ): , , , , , ; § лЁ (лLatinЁ) -- лЁ -- : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , ; (3) ( SMALL CAPS ): , , , , , ; (4) ( Bold ): , , , , , ; (5) ( Bold OT1, T1, T2A T2D. , : § "" , , http://lizard.phys.msu.su 5 , - . T2A T2D, , , . ...

Еще в разделе: (Показать все результаты (>17) - lizard.phys.msu.su/ )