... All rights reserved finmen.spa@mail.ru : : hcp://spa.msu.ru/page_325.html : hcp://vk.com/mh_msu_fgu_finance .. ... All rights reserved / () · : · : LIBOR ( London Interbank Offered Pate), MIBOR ( Moscow Interbank Offered Pate) · :LIBID (London Interbank Bid), MIBID (Moscow Interbank Bid) · : MIACR (Moscow Interbank Ac·al Credit Rate) · : Prime- rate, Mosprime- rate .. ... All rights reserved · ­ , t i B ­ D =- - - - - - - - - - - - - - t - 360 i - , 100% · .. ... All rights reserved · , · APR ­ , . ...

Еще в разделе: (Показать все результаты (>31) - www.spa.msu.ru/ )

• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2702_finance_analysis.pdf
• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2002_finance_analysis.pdf
• Список полнотекстовых баз данных

Еще в разделе: (Показать все результаты (>5) - termogaz.imec.msu.ru/ )

. People on #C4ACTbE as of 18 Jan 2001 18:45 MSK . Nickname . Status . User@Host . C4ACTbEP . idle . This is me, the channel bot. XAM[c] . idle . u0948@mvs.imm.uran.ru . Igorek . idle . igorek@kronos.psu.ru . Berendeev . - . graffity@ts16-a82.dial.sovam.com . Created by quesedilla v3 via eggdrop This page is automatically refreshed.

Еще в разделе: (Показать все результаты (>4) - asa.guru.ru/ )

... Prof, head of the laboratory of x-ray diffraction and crystal chemistry Home address: Russia, 115470, Prosp. ... 1964-1969 a student of Geological faculty MSU, department of crystallography 1969-1973 a post graduate student (scientific advisor academician N.V.Belov) 1974 Ph.D., speciality 'Crystallography and Crystalphysica', title of Ph.D. Thesis 'Crystal structures of (Na,Cd)-germanates' 1994 D.Sc., speciality 'Physical chemistry', title of D.Sc. ... E.L.Belokoneva, L.I.Leonjuk, V.S.Urusov. ...

Еще в разделе: (Показать все результаты (>47) - cryst.geol.msu.ru/ )

... Абакумова Г.М., Горбаренко Е.В. Прозрачность атмосферы в Москве за последние 50 лет и ее изменения на территории России (ЛКИ, 2008, paperback, 192 p., 240 roubles) . Аветисов Г.П. Арктический мемориал 2006г. (Наука, 2006, hardcover, 618 p., 610 roubles) . Алексеев В.В. Лабораторные модели физических процессов в атмосфере и океане (Наука, 2005, hardcover, 312 p., 290 roubles) . ... Ананьев В.П., Потапов А.Д. Инженерная геология (Высшая школа, 2007, hardcover, 575 p., 800 roubles) . ...

Еще в разделе: (Показать все результаты (>13814) - www.mce.biophys.msu.ru/ )

• Files

Call Title: Call for proposals for ERC Starting Independent Researcher Grant Call identifier: ERC -2012-StG Date of publication: 20 July 2011 Electronic proposal submission deadlines1 (single submission of full proposal): 2 Domain Physical Sciences Engineering (Panels PE1 - PE10): 12 October 2011, 17.00.00 (Brussels local time) Domain Life Sciences (Panels LS1 ­ LS9): 9 November 2011 17.00.00 (Brussels local time) Domain Social ... See section 4.6 and Annex 9 of the work programme. ...

Еще в разделе: (Показать все результаты (>35) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/press_release_StG_2012.pdf
• http://ideas.msu.ru/docs/call_SyG_2012.pdf

... Larin A.V, Rybakov A.A., Zhidomirov G.M. Journal of Physical Chemistry C, 116, 2399-2410 (2012). ... Larin A.V, Rybakov A.A., Zhidomirov G.M., Mace A., Laaksonen A., Vercauteren D.P. Journal of Catalysis, 281, 212-221 (2011). ... A.A. Rybakov, A.V. Larin, G.M. Zhidomirov, D.N. Trubnikov, D.P. Vercauteren . ... A. A. Rybakov, E. D. Belega, and D. N. Trubnikov . Journal of Chemical Physics, 133, 144101 (2010) . ... The following article may be found on the site of Journal of Chemical Physics.) ...

Еще в разделе: (Показать все результаты (>25) - beams.chem.msu.ru/ )

... Телефон +7 (495) 690 35 56 . Факс +7 (495) 690 05 28 . ... Язык и когнитивная система, дискурс, семантика, грамматика, функционалистская теория языка, лингвистическая типология, ареальная лингвистика, языковое разнообразие, полевая лингвистика, индейские языки, атабаскские языки, тюркские языки, кавказские языки, западноафриканские языки, русская грамматика. ...

Еще в разделе: (Показать все результаты (>335) - www.philol.msu.ru/ )

• LangueDOC :: Movie
• LangueDOC :: Publications

... Географии мирового хозяйства . ... География" . ... 31 January 2015 Deadline for submitting abstracts for papers and posters . ... Thematic session ? ... Session title: Evolution of Earth Cryosphere in changing climatic conditions and . ... Monitoring of cryosphere components is essential in understanding climatic and environmental variability and trends. ... When submitting, first select the category and specific session in which you wish to place your abstract (see the session list). ...

Еще в разделе: (Показать все результаты (>38344) - www.geogr.msu.ru/ )

• Конференция IGU
• Список ссылок
• CONTENTS ?1 - 2011

Neutrino telescope in Northern Hemisphere . ... about ANTARES . ... ANTARES is the name of a neutrino telescope residing in the Mediterranean Sea off the coast of Toulon, France. ... Other neutrino telescopes designed for use in the nearby area include the Greek NESTOR telescope and the Italian NEMO telescope, which are both in early design stages. ... In contrast to the South Pole neutrino telescopes AMANDA and IceCube, ANTARES uses water instead of ice as its Cherenkov medium. ...

Еще в разделе: (Показать все результаты (>21) - antares.sinp.msu.ru/ )

... Term3 Цель: сравнить записи банка данных EMBL, полученные в ответ на запрос по accession number белка MALK_ECOLI. ... ID записи EMBL . ... Длина посл. ... Геномная ДНК . Стандарт . ... Escherichia coli K12 MG1655, complete genome. ... Раздел EMBL: Т.к. все найденные записи содержат данные о ДНК прокариотныз организмов, они относятся к разделу "PRO". Дата создания документа: Видно (и вполне логично), что полный геном Escherichia coli был секвенирован гораздо позже, чем отдельные гены. ...

Еще в разделе: (Показать все результаты (>3890) - kodomo.cmm.msu.ru/ )

• Pouliakhina's page
• Department of animal cell biochemistry - Staff and contacts
• Evolution

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>140) - ee-journal.spa.msu.ru/ )

... Dmitry Stepanovich (VIDEO of March 2011) . Olga Silchenko, a soloist of the Early Music Theatre . ... Anna and Olga Silchenko have presented the duets by Rubinstein and Chaikovsky (VIDEO) . ... Two Russian romances - duets by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... N. Rimsky-Korsakov "The Tsar's Bride", the duet of Lubasha and Gryaznoy - by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... Vivaldi "Magnificat", 6th part, duet by Anna and Olga Silchenko (VIDEO) . ... Olga Silchenko . ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

... Species Plantarum (1st edition, 1753) . C. Linnaeus. Species plantarum: exhibentes plantas rite cognitas ad genera relatas. Tomus I. 574 p. Holmiae: L. Salvii. ... Djvu, 19 Mb . ... Systema Naturae (12th edition, 1766--1768) . ... Systema naturae per regna tria naturae: secundum classes, ordines, genera, species cum characteribus, differentiis, sinonimis, locis. ... Systema naturae per regna tria naturae: secundum classes, ordines, genera, species cum characteribus et differentiis. ...

Еще в разделе: (Показать все результаты (>679) - herba.msu.ru/ )

• Phenology (2002)
• What's new?
• INTERNATIONAL SYMPOSIUM

... G. F. Handel: Messiah - Part the Third . Г. Ф. Гендель: Мессия - Часть третья . Part II . Часть II . ... PART THE THIRD . ЧАСТЬ ТРЕТЬЯ . ... Air (soprano) I know that my redeemer liveth, . ... yet in my flesh shall I see God. ... For now is Christ risen from the dead, . ... Chorus Since by man came death, . ... even so in Christ shall all be made alive. ... Air (bass) The trumpet shall sound, . ... Chorus But thanks be to God, . ... Air (alto) If God is for us, who can be against us? ...

Еще в разделе: (Показать все результаты (>22) - music.genebee.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>231) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services
• Impact Factors of Scientific Journals in 1999

How to sequence a glacier: a computational biologist's rough guide Sulbha Choudhari, Ruchi Lohia, Andrey Grigoriev Rutgers University, 315 Penn St, Camden NJ 08055, USA, agrigoriev@camden.rutgers.edu This talk will describe the motivation behind sequencing a glacial environmental sample, challenges in collecting and sequencing it as well as the insights from the analysis of the results and comparisons with other metagenomes. ... Other estimates also suggested relative simplicity of glacial life. ...

Еще в разделе: (Показать все результаты (>286) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/7.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/222.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>39) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf
• http://www.innovation.msu.ru/russian/methodsforfinancingfourcompany_rus.pdf

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>161) - www.pereplet.ru/ )

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )