... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>15) - engineering.phys.msu.ru/ )

• Noise Meter
• Projects
• Circuit Diagnostics

Setting Up a Pay System Canada Business Service Centres - CBSCs Last Verified: 2004-05-28 Document No. 4046 Summary Pay administration is a management tool that enables you to control personnel cost, increase employee morale, and reduce work force turnover. ... This publication provides time-tested concepts for determining competitive pay levels and for maintaining fair pay relationships among the jobs comprising a small company. ... appraise employee performance under the plan. ... job title; . ...

Еще в разделе: (Показать все результаты (>18) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/yourmarketingstrategy.doc
• http://www.innovation.msu.ru/english/reportofinvention.doc
• http://www.innovation.msu.ru/english/marketingplanoutline.doc

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>44) - sn.sai.msu.ru/ )

Course description: . The eighteenth century has often been described as a century of women. As Enlightenment thinkers challenged traditional ideas about the nature of society and government, they also rekindled the debate about woman's place in society. Women themselves contributed to these debates, assuming a prominent public role as salon hostesses and as enthusiastic consumers and producers of print culture. ... Week 1: Women in Enlightenment Philosophy . ... Women and Science . ...

Еще в разделе: (Показать все результаты (>96) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

Geometric Structures in Integrable Systems Sergey Adzhiev (with Victor Vedenyapin), Entropy for generalised quantum kinetic and Liouville equations. Abstract: In his 1872 paper L. Boltzmann proved H-theorem for a class of kinetic equations. ... Abstract: P. Clarkson and M. Kruskal (1989) proposed a method for finding reductions of partial differential equations with two independent variables. ... Gennady El, Kinetic equation for a soliton gas ­ a new integrable system? ...

Еще в разделе: (Показать все результаты (>36) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/spec/Materialy_po_kursam_Tutubalina/Finstat/Bashelie/Bachelier100years.pdf
• http://new.math.msu.su/department/probab/bsk15_2.htm

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>22) - lcl.srcc.msu.ru/ )

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>37) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a
• Oleg G. Koshelev

Программа CRYSTAL предназначена для выполнения простейших геометрических операций с различными кристаллическими структурами, как наиболее известными, уже заложенными в программу, так и произвольными, задаваемыми пользователем. Программа позволяет строить плоскую и трехмерную проекции вдоль произвольного направления, а также на качественном уровне сравнивать условия для движения частиц в различных направлениях в кристалле. ... 2) При запуске программа выдает два меню: . ... ДЕМО - ВЕРСИЮ . ...

Еще в разделе: (Показать все результаты (>3) - np-chair.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... file but would like it to be automatically updated # again, run the following command: # sudo dpkg-reconfigure -phigh xserver-xorg Section Files EndSection Section InputDevice Identifier Generic Keyboard Driver kbd Option CoreKeyboard Option XkbRules xorg Option XkbModel pc105 Option XkbLayout us ...

Еще в разделе: (Показать все результаты (>32) - observ.pereplet.ru/ )

Ideal Polymer Chain. ... Chain with a Fixed Valency Angle. ... Indeed, consider for example the model with fixed valency angle between the segments of length b (assume for simplicity that u() = 0): C C C As before R u n 2 = i =1 j =1 2 n n ui u j = i =1 j n u 2 i + 2 i = b , but now u i u i , j =1, i j n ui u j , 0 Instead of that we have: R 2 = Nb + b 2 2 i , j =1 i j cos ij , where ij is an angle between ith and jth segments. ... Persistent Length of a Polymer Chain. ... Stiff Chains vs. ...

Еще в разделе: (Показать все результаты (>90) - polly.phys.msu.ru/ )

• Science
• Timetable - Chair of Polymer and Crystal Physics

... The name IE2DP1 means: Integral Equation (method of decision), 2D (dimension), P (point current electrodes), 1 - across inhomogeneities. IE2DP1 program fulfills two dimensional (2D) electric field modeling for different modifications of resistivity and induced polarization (IP) field techniques. ... Apparent chargeability is saved always in the file "IE2DP1.RES" and reference point is in current electrode location. ... Number of angular points for one body more than 40 5. ... Run file "start.bat". ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• IPI_MTS - 1D interpretation of MTS and FS (freeware).
• TES. Field example.

Vol.30,1978 435 A remark on nonsymmetric compact Riemann By surfaces D~AR G~B~ Let G be a group of automorphisms of a compact Riemann surface of genus g > 1. ... Singerman Eves one of genus g ---- 17 and some others of higher genus. this note we classify all K-automorphism groups of compact Riemann surfaces of genus 7. ... Apart from isomorphic copies there exist exactly two nonsymmetric Riemarm surfaces of genus 2 g g < 7 whose group is a K-automorphism group. ...

Еще в разделе: (Показать все результаты (>24) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/0articles/Ilyutko/0904.2862v1.pdf
• http://dfgm.math.msu.su/files/0articles/Zheglov/GTM.pdf
• http://dfgm.math.msu.su/files/ivanov-tuzhilin/Lecture_Notes.pdf

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>13) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/INFN%20-%20ANTARES.pdf
• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20NEMO.pdf

... COLAMO [1] . Fire!Constructor [2], . ... Fire!Constructor ( Include COLAMO). ... 4 - Fire!Constructor COLAMO - ARGUS. ... ARGUS : Define N = 5; Define K = 6; Define M = 1; DMC[0.A] # Metka : Read A step M repeat K; Add A, K; Loop N Goto Metka; DMC[0.C] # Metka1 : Read C step M repeat K; Add C, K; Loop N Goto Metka1; DMC[0.D] # Metka2 : Read D step M repeat K; Add D, K; Loop N Goto Metka2; DMC[0.B] # Metka3 : Write B step M repeat K; Add B, K; Loop N Goto Metka3; Read ­ , (.. ...

Еще в разделе: (Показать все результаты (>8) - fpga.parallel.ru/ )

• Суммирование элементов массива

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>33) - cosmos.msu.ru/ )

• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,

ft ra D DAYS on DIFFRACTION 2012 1 Theory of selfrefraction effect of intensive fo cused acoustical b eams V.A. Gusev Lomonosov's Moscow State University, Physical Faculty, Department of Acoustics, Russia, 119991, Moscow, Leninskie gori; e-mail: vgusev@bk.ru The theory of selfrefraction of nonlinear acoustical beams is developed based on some exact and approximate analytical equations and solutions. ... What is the main factor limiting the pressure in the focus -- diffraction or selfrefraction? ...

Еще в разделе: (Показать все результаты (>37) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/trubochki.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/ursi2.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/shwaan1.pdf

... Vernadskogo 78, Moscow, 119454 Russia e mail: fedyanin@nanolab.phys.msu.ru Received June 23, 2011 a Local polarization properties of a gold subwavelength grating with plasmon induced linear dichroism are studied by scanning near field optical dynamic polarimetry. ... Scanning near field optical microscopy images of (a) the nanograting sample obtained without intensity modulation and (b, c) the sample illuminated with intensity modulated linearly polarized light. ...

Еще в разделе: (Показать все результаты (>45) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/thg_in_fishnet.pdf
• http://nanolab.phys.msu.ru/sites/default/files/apl97_261908_2010.pdf
• Ultrafast magnetophotonics | Laboratory of Nanophotonics & Metamaterials

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf