... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>8) - iconolat13.phys.msu.ru/ )

• Guidelines

.

Еще в разделе: (Показать все результаты (>195) - nuclphys.sinp.msu.ru/ )

• The European X- Ray Free-Electron Laser

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>117) - vestnik.math.msu.su/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/NIMA.pdf

... Поступление иностранных граждан . ... Russian Language Program . ... General Russian Courses . Courses of Russian for Specific Purposes . How to Register for a Course and Receive the Entrance Visa . ... The Faculty of Foreign Languages and Area Studies at Moscow State University offers courses of General Russian to learners of all levels from Absolute Beginners through to Advanced. ... If you would like to register for a course please provide us with the following information: . ...

Еще в разделе: (Показать все результаты (>73) - ffl.msu.ru/ )

• About Us

... education . research . ... Functional Nanomaterials . ... Composite Nanomaterials Master?s Program . educational program . ... MSU and RAS leading scientists have devised fundamental courses (approx. 20% of the program) to provide essential knowledge in composites, a number of novel lecture and practical courses (approx. 50% of the program.) ... After completion of the program and defense of Master?s degree papers, students receive Master?s degrees from MSU. ...

Еще в разделе: (Показать все результаты (>13) - nano.msu.ru/ )

• Announcement about the admission to MSU Graduate School for a new Master?s

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>17) - hcs.cmc.msu.ru/ )

• Master program "Information Security and Cryptography" | Магистерское и
• Master program "Enterprise Information Systems" | Магистерское и послевузовское

... E. Huhlaev, Metamake Tools for Personal Project Preparation in Heterogeneous Network Environment (ID=260), Word doc . ... O. Kodolova, Experience with OO Database for CMS Events Distributed Between Two Sites (ID=294), PDF file . ... A. Nikitin, The GA Based Approach to Optimization of Parallel Calculations in Large Physics Problems (ID=220), Word doc . ... J. Seixas, Neural Particle Discrimination for Triggering Interesting Physics Channels Using Calorimetry Data (ID=311), PDF file . ...

Еще в разделе: (Показать все результаты (>62) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-06-ResourceManagement1.pdf
• http://acat02.sinp.msu.ru/visa.html
• http://acat02.sinp.msu.ru/presentations/severyanov/Severyanov-poster.ps

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>76) - qilab.phys.msu.ru/ )

• Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

... If one considers the two-photon field, generated via the spontaneous parametric down-conversion (SPDC) process, then the pure polarization state can be written as a superposition of four basic components: ji c1 jH1 ;H2 i c2 jH1 ;V2 i c3 jV1 ;H2 i c4 jV1 ;V2 i: 0031-9007= 06 =97(2)=023602(4) (1) Here ci jci jeii , (i 1, 2, 3, 4) are complex probability amplitudes, jHj i ayj jvaci, jVj i byj jvaci, where j , (j 1, 2) are the central wavelengths of down-converted photons. ... Phys. Rev. Lett. ...

Еще в разделе: (Показать все результаты (>80) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/kulik/Papers/OS684.pdf
• http://qi.phys.msu.su/papers/2007-jetp(e)-104-736.pdf
• http://qi.phys.msu.ru/kulik/Papers/JETP_Shurupov07.pdf

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>11) - www.sciencepark.ru/ )

... Commission on Paleopedology . ... THE FIRST SCIENTIFIC DESCRIPTION OF EUROPEAN LOESS-PALEOSOL SEQUENCES - Alexander Makeev 08/3/2006 ( 0) . ... paleosol] Re: PalaeoPedology as a Commission - Dr.Stephen Nortcliff 27/11/2003 ( 0) . paleosol] Re: PalaeoPedology as a Commission - dan yaalon 26/11/2003 ( 0) . paleosol] Re: The future of the Paleopedogy Commission - Mermut 28/9/2003 ( 0) . ... Definition of paleosol and geosol; memo to John Catt - Roger Morrison 10/10/99 ( 1) . ...

Еще в разделе: (Показать все результаты (>2) - www.paleopedology.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

... Войти в систему . ... Издательство: Central European Science Journals . ... в журнале Central European Journal of Physics , издательство Central European Science Journals (Poland) , том 11, ? ... Tarasov Vasily E. в журнале Central European Journal of Physics , издательство Central European Science Journals (Poland) , том 11, ? ... Tarasov V.E. в журнале Central European Journal of Physics , издательство Central European Science Journals (Poland) , том 10, ? ...

Еще в разделе: (Показать все результаты (>2806) - istina.msu.ru/ )

• Sofiev M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Vazquez M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Rodrigo A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>119) - srcc.msu.ru/ )

• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• V.B.Semikoz, D.D.Sokoloff, J.W.F. Valle, Lepton asymmetries and primordial

( ) .. , . . , . . .. (e-mail: polevikm@rambler.ru ) , , , quality of research, failing and error research, the system of research, qualitative research , ; . The necessity of the use of research for decision -making on the information received, are considered typical examples of the use of integrated systems research in the practice of the organization, approaches and assess the quality of research and study quality as a subject of study.

Еще в разделе: (Показать все результаты (>28) - vestnik.socio.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... win] как сделать перезагрузку по расписанию? . ... Re: [win] как сделать перезагрузку по расписанию? [ re: Weasel ] . ...

Еще в разделе: (Показать все результаты (>3339) - www.fds-net.ru/ )

• who want to receive a call at 22:00 tomorrow? - Public forum of MSU united
• как в матлабе записать квадратную матрицу в файл тхт? - Public forum of MSU
• прога удаленного форматирования по дате - Public forum of MSU united student

... Russian Securities in the Russian and European Stock Exchanges (end of the 19th - beginning of the 20th century), . ... This article is devoted to the process of the Russian securities market's formation from the 1890's to 1913. By the end of this period, Russian securities played a noticeable role in the European stock exchanges. The article studies the issues' dynamics and the market price of Russian securities quoted by domestic and international stock markets. ...

Еще в разделе: (Показать все результаты (>242) - hist.msu.ru/ )

• "Novaya i noveishaia istoria" Journal
• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• Economic History. Yearbook. 2001

. This is the default web page for this server. The web server software is running but no content has been added, yet.