Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>21) - antares.sinp.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>191) - nuclphys.sinp.msu.ru/ )

• A.M.Baldin

... Женский клуб . ... Издательство МГУ . ... Сотрудники Университета Лаваль, Университетского госпиталя Квебека и компании GlaxoSmithKline заявляют: им удалось подойти вплотную к получению вакцины против болезни Альцгеймера, пишет The Best medical cover . Ученые выделили молекулу MPL, на которую они, как раз, делают основную ставку. ... The molecule, known as MPL (monophosphoryl lipid A), has been used extensively as a vaccine adjuvant by GSK for many years, and its safety is well established. ...

Еще в разделе: (Показать все результаты (>243) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC
• Клуб выпускников МГУ: Конференция "Вакансии"

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>10) - psyberlink.flogiston.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>158) - www.pereplet.ru/ )

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>115) - sai.msu.ru/ )

• European Astronomical Society(EAS): NEWS
• General Catalogue of Variable Stars: Vols I-III (the new electronic version).

... 6 4, 53^57, 20 01 The Local Plasma Frequency Approach in Description of the Impact-Parameter Dependence of Energy Loss V. A. Khodyrev* Institute of Nuclear Physics, Moscow State University, Moscow 11989 9, Russia Received October 26, 2 0 0 0; revised ... The local energy loss is determined by the induc ed electron current and the intensity of the projectile ў eld at a given point. ... Fig. 3 shows also the results of calculation of DE b based on the static electron gas model (ek; o from Eq. ...

Еще в разделе: (Показать все результаты (>101) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LAS/Nimb254_jan07_200Shulga.pdf
• http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf
• http://danp.sinp.msu.ru/LIIWM/PRLett79_1997_1662NMKab.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... University of Groningen, The Netherlands . PhD Position available . ... PhD Position in Theoretical Chemistry . ... She is considered to be one of top 5 universities in Europe for research in Materials Science, Chemistry, Space Science, Microbiology, and Environment/Ecology. ... In 1993, the MSCplus was accredited by the Royal Netherlands Academy of Arts and Sciences (KNAW) as a leading Research School in Materials Science. ...

Еще в разделе: (Показать все результаты (>76) - www.physcareer.ru/ )

Vestnik zoologii, 45(2): 187--190, 2011 УДК 565.76(477) NEW SPECIES OF STILBUS (COLEOPTERA, CLAVICORNIA, PHALACRIDAE) FROM THE LATE EOCENE ROVNO AMBER G. Yu. ... Perkovsky E. E. - The first Eocene species of Stilbus Seidlitz, 1872, S. bedovoyi Lyubarsky et Perkovsky, sp. n., is described from Late Eocene Rovno amber. ... Key words: Phalacridae, Stilbus, Late Eocene, Rovno amber. ... Rovno amber is a southern coeval analogue of the famous Baltic amber (Perkovsky et al., ...

Еще в разделе: (Показать все результаты (>1593) - zmmu.msu.ru/ )

• Towards the taxonomy of the Russian Murina (Vespertilionidae, Chiroptera)
• Uropatagium venation pattern in bats as diagnostic character (by the example of

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>108) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• V.B.Semikoz, D.D.Sokoloff, J.W.F. Valle, Lepton asymmetries and primordial

... -department of Environmental Technology, Wageningen University, PO Box 8129, 6700 EV Wageningen, The Netherlands Keywords Mathematical model ф Upflow anaerobic sludge bed reactor ф Dispersion ф Plug flow ф Sedimentation Nomenclature Coefficients in empirical equations A AC Ash content of the dry sludge aggregates (%) b Bacterial (death+lysis) rate coefficient ( dayю1 ) COD Chemical oxygen demand (g) CS ... Narnoli SK, Mehrotra I (1997) Sludge blanket of UASB reactor: mathematical...

Еще в разделе: (Показать все результаты (>128) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ryabov/pdf/JBIC_99.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/dpfl_model.pdf
• http://www.enzyme.chem.msu.ru/ryabov/pdf/JBIC_97.pdf

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ­ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

International Symposium Quasifission Process in Heavy Ion Reactions Messina (Italy) November 8-9, 2010 First Circular Chairman : Giorgio Giardina ( Messina ) Co-Chairman: Avazbek Nasirov (Dubna) Co-Chairman: Sara Pirrone (Catania) Scientific Secretary: Giuseppe Mandaglio ( Messina ), and Alessia Di Pietro (Catania) Local Organizing Committee: Giovanni Fazio ( Messina ), Giorgio Giardina ( Messina ), Giuseppe Mandaglio ( Messina ), Marina Manganaro ( ...

Еще в разделе: (Показать все результаты (>123) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/d4d/registration-eng-ru.doc
• http://phys.msu.su/rus/international/intl-collaboration-agrmnts/docs/JASSO%20scholarship%20informaiton_Tohoku2016.pdf
• http://phys.msu.su/upload/iblock/47c/NEPCAP%202012.pdf

( ) .. , . . , . . .. (e-mail: polevikm@rambler.ru ) , , , quality of research, failing and error research, the system of research, qualitative research , ; . The necessity of the use of research for decision -making on the information received, are considered typical examples of the use of integrated systems research in the practice of the organization, approaches and assess the quality of research and study quality as a subject of study.

Еще в разделе: (Показать все результаты (>36) - vestnik.socio.msu.ru/ )

... They elected her to represent them on the committee. 4.to lose elections ­ to receive an amount of money paid by government or company, to someone who can no longer earn money by working. ... The government must introduce new tough policies to reduce unemployment. 8.to give glimpses ­ a person who travels from place to place and holds religious meetings in the open air to persuade people to become Christians. ... Most students have to stretch their money while studying away from home. ...

Еще в разделе: (Показать все результаты (>24) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Academic_English_part1.pdf
• http://www.eng.math.msu.su/download/Academic_English_part2.pdf

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>14) - ocean.phys.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>215) - observ.pereplet.ru/ )

Towards celestial sources above 1 THz with a heterodyne receiver based on a hot-electron bolometer mixer Sergey Ryabchun, Ivan Tretyakov, Matvey Finkel, Natalia Kaurova, Boris Voronov and Gregory Gol'tsman HOT-ELECTRON BOLOMETER (HEB) MIXER Scient ific and Educatio nal Radiophysics Center Mo scow State Pedago gical University Mo scow, Russia FIRST GROUND-BASED OBSERVATION WITH HEB MIXERS BEYOND 1 THz Submillimeter Telescope ...

Еще в разделе: (Показать все результаты (>24) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/VKornilov_site2010.pdf
• http://site2010.sai.msu.ru/static/doc/OVoziakova_site2010.pdf.pdf

... proposals* are presented by multinational consortia of organisations/individuals Proposals are evaluated by independent experts All proposal coordinators receive an Evaluation Summary Report Funding follows successful evaluation, selection and negotiation of grant agreement * except certain Support actions ··· 2 Who can participate · Three independent legal entities from three different EU Member States or Associated countries (presently ... 19 Proposals and projects in FP7 3. ...

Еще в разделе: (Показать все результаты (>104) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/101021-moscow-eu-ru-call.pdf