1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Book 1 Containing the years from the beginning of the World, or from the year of the Juliam Period 730 unto the third of Solomon, which is the 3702 year of the same Period . ... Book 5 Containing years from the first of CHRIST to the Thirty fourth . Book 6 Wherein are contained the years from the 304 of CHRIST unto 491 . Book 7 Wherein are contained the years from the 491 of CHRIST unto 641 . Book 8 Wherein are contained the years from the 641 of CHRIST unto 1100 . ...

Еще в разделе: (Показать все результаты (>89) - hbar.phys.msu.ru/ )

• Historical Eclipses
• The jump of the second derivative of the moon's elongation
• newtrev1.htm

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>50) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Leading scientific fellow Sergey Piskarev Ph.D.

... include stdio.h # include stdlib.h int main( int argc, const char* argv[]) { FILE* f; int c, wordCnt = 0, inWord = 0; if (argc 2) { printf ( Use: %s filename\n , argv[0]); return 1; } f = fopen(argv[1], r ); if (f == NULL) { printf ( Can't open file: %s\n , argv [1]); return 1; } while ((c = fgetc(f)) if (!isspace(c)) if (! inWord ) { ++wordCnt; inWord = 1; } } ... int main() { enum {RUNNING, STOPPED} state; state = RUNNING; state = STOPPED; } RUNNING STOPPED · : 1. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

• http://savenkov.lvk.cs.msu.su/mc/lect01.pdf

V. V. KOZLOV Department of Mechanics and Mathematics Moscow State University, Vorob'ievy Gory 119899, Moscow, Russia E-mail: vako@mech.math.msu.su KINETICS OF COLLISIONLESS CONTINUOUS MEDIUM Received June 8, 2001 DOI: 10.1070/RD2001v006n03ABEH000175 In this article we develop Poincarґ ideas about a heat balance of ideal gas considered as a collisionless continuous medium. e We obtain the theorems on diffusion in nondegenerate completely integrable systems. ... d3 2 2 For the Maxwell distribution = 1. ...

Еще в разделе: (Показать все результаты (>109) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/4bf/191-the-bifurcation-analysis-and-the-conley-index-in-mechanics_ru.pdf
• http://ics.org.ru/upload/iblock/c96/169-the-vlasov-kinetic-equation-dynamics-of-continuum-and-turbulence_ru.pdf
• http://ics.org.ru/upload/iblock/268/pu_58_1220.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

Программирование диалогов 1. ... Написание диалоговой функции: float dedit = 0.; BOOL CALLBACK DialogProc (HWND hDlg ,UINT uMsg, WPARAM wParam ,LPARAM lParam) { char str [80]; switch (uMsg) { case (WM_INITDIALOG): sprintf( str , %5.2f , dedit ); SetDlgItemText( hDlg ,IDD_EDIT, str ); //CheckDlgButton( hDlg ,IDD_RED, TRUE ); return TRUE ; case WM_COMMAND: switch (LOWORD ( wParam )) { case IDOK: GetDlgItemText( hDlg ,IDD_EDIT, str ,80); //IsDlgButtonChecked( ...

Еще в разделе: (Показать все результаты (>70) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/science_education/lections/CS/cp/First.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2016/Bychkov_Karabutov_en.pdf

Open Conference Systems . ... Conference Content Search . All Authors Title Abstract Index terms Full Text . ... January February March April May June July August September October November December 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 0 . ... By default only papers containing all terms in the query are returned (i.e., AND is implied) . Combine multiple words with OR to find papers containing either term; e.g., education OR research . ...

Еще в разделе: (Показать все результаты (>24) - hea.phys.msu.su/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>90) - npidb.belozersky.msu.ru/ )

• Index of /data
• Index of /data/html_scop
• Index of /data/pdb_new

PHOTO GALLERY . ... 2013) . ... Thesis defence . ... After the defence . ... Reihstags (2013) . ... Parthenon (2013) . ... Greece (2013) . ... Germany (2013) . ... Moscow Region (1999) . ... Moscow . ... Moscow State University . ... View of Moscow . ... Moscow, Red Square . ... Scotland (2002) . ... Scotland . Bridge to the Future . Edinburgh Castle . London, Tower Bridge . Edinburgh Church . ... Ancient Rome Ruins . ... Rome (2005) . Rome, St. Peter's Church . Alps, Italy . ...

Еще в разделе: (Показать все результаты (>164) - polly.phys.msu.ru/ )

• SfP 974173 Polymer Gels - Summary Report - May 2002
• LCOptimizer Software
• Science

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

• Index of /about_center/workplaces

MPI. ... C: #include <mpi.h> 14 MPI MPI- C (case sensitive): error = MPI_Xxxxx(parameter,.. ... Send : , , ­ Receive: , , 27 MPI () MPI - , (blocking) (non-blocking) ­ Blocking: ­ Non-blocking: , 28 MPI (modes) (Mode) Synchronous send Buffered send Standard send Ready send Receive (Completion Condition) ( ), ( ) ( ), 29 MPI «-» () (MODE) Standard send Synchronous send Buffered send Ready send Receive MPI MPI _ Send MPI _ Ssend MPI _ Bsend MPI _ Rsend ...

Еще в разделе: (Показать все результаты (>5) - angel.cmc.msu.ru/ )

• Index of /~basrav/supercomp2010

function [result] = scheme2System( fileName ) links = zeros(100, 100); function [n] = getBlockNum(BlockName) n = -1; for i = 1:size( blocks ,2) if( strcmp (BlockName, blocks (i). name ) ) n = i; return; end end end function makeLinks( src ) s = fgets (f); while ~ strcmp ( strtok (s), '}') [s r] = strtok (s); if( strcmp (s, 'Branch')) makeLinks(src) elseif( strcmp (s, 'DstBlock') ) r = strrep (r, ' ', '');% ...

Еще в разделе: (Показать все результаты (>4) - ndsipu.cmc.msu.ru/ )

• Кривоножко Владимир Егорович | Кафедра НДСиПУ

. Fatal error : Can't use method return value in write context in /webs/cacs/system/application/modules/changepass/controllers/changepass.php on line 17 .