include stdio.h #include math.h double fdet ( float d, float c, int n ); int fau ( float d, float c, int n, double ua[] ); void fld ( float d, float c, int n, double ld[] ); void fv ( int n, double vld [] ); void main() { int i, i1, j, j1, n = 5 ; float d = 2., c = 1., det ; double ld[ 10 ], ua[100], vld [100]; ...

Еще в разделе: (Показать все результаты (>547) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/meth_mat/prac_alg/arfil/symfor1.txt
• http://num-anal.srcc.msu.su/eng_math/redict/3.htm
• БЧА НИВЦ МГУ. ZF30R. Решение системы уравнений общего вида

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>360) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR_EDIT
• Riga, 1969
• Meeting of 2 school in April 01, 1972

... The 1973 eruption on the island of Heimaey is a classic example of the struggle between man and volcanoes. With a heroic effort the people of Iceland saved the town of Vestmannaeyjar and the country's most important fishing port. ... The island of Heimaey with the growth of the island in 1973, the location of the eruptive fissure, and the location of Eldfell, the 1973 cone. ... View of Heimaey before the eruption. ... Eldfell and the 1973 lava flows are just beyond the town. ...

Еще в разделе: (Показать все результаты (>296) - geo.web.ru/ )

• Commission on the chemistry of volcanic gases (CCVG). IAVCEI 11th Gas workshop
• Fridricksburg
• dwelling

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>6) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~dimawolf/ArchEVM/Lection12.pdf

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>16) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details.pdf

... include stdio.h # include stdlib.h int main( int argc, const char* argv[]) { FILE* f; int c, wordCnt = 0, inWord = 0; if (argc 2) { printf ( Use: %s filename\n , argv[0]); return 1; } f = fopen(argv[1], r ); if (f == NULL) { printf ( Can't open file: %s\n , argv [1]); return 1; } while ((c = fgetc(f)) if (!isspace(c)) if (! inWord ) { ++wordCnt; inWord = 1; } } ... int main() { enum {RUNNING, STOPPED} state; state = RUNNING; state = STOPPED; } RUNNING STOPPED · : 1. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

• http://savenkov.lvk.cs.msu.su/mc/lect01.pdf

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>139) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• RNA kinetics server
• SDPsite - Gallery of examples

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>5457) - monkey.belozersky.msu.ru/ )

• SDPpred
• Example of supporting positions
• ETS numeration assumed

... Reliable records of solar and lunar eclipses go back as far as 750 B. C. They bear on such questions as whether the sun is shrinking or the earth is not spinning as fast as it once did . ... On the second only the records of total solar eclipses since the 18th century are pertinent. ... Whether a given solar eclipse is total or annular (with a bright ring of sun surrounding the disk of the moon) depends on the position of the moon in its elliptical orbit. ... TOTAL: "ENTIRE SUN ECLIPSED" . ...

Еще в разделе: (Показать все результаты (>82) - hbar.phys.msu.ru/ )

• Robert R. Newton, The Secular Acceleration of the Earth's Spin
• The Theft of the Millenium. Review on a Review.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>19) - tukachev.flogiston.ru/ )

• Category: Новости

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ­ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>129) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/QFTHEP_Novikov.pdf
• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf
• http://qfthep.sinp.msu.ru/talks/GRACE.pdf

Программирование диалогов 1. ... Написание диалоговой функции: float dedit = 0.; BOOL CALLBACK DialogProc (HWND hDlg ,UINT uMsg, WPARAM wParam ,LPARAM lParam) { char str [80]; switch (uMsg) { case (WM_INITDIALOG): sprintf( str , %5.2f , dedit ); SetDlgItemText( hDlg ,IDD_EDIT, str ); //CheckDlgButton( hDlg ,IDD_RED, TRUE ); return TRUE ; case WM_COMMAND: switch (LOWORD ( wParam )) { case IDOK: GetDlgItemText( hDlg ,IDD_EDIT, str ,80); //IsDlgButtonChecked( ...

Еще в разделе: (Показать все результаты (>50) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/science_education/lections/CS/cp/First.pdf

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>42) - www.msu.ru/ )

• http://www.msu.ru/projects/amv/doc/h6_1_6_1_nom8_2.pdf

... class applied_topology(ost.Topology.Abstract): #, # p1 self.edges[p1] # p2 p1 7 self.edges = { p1: [p1_1,...,p1_k1] p2: [p2_1,...,p2_k2] ... pM: [pM_1,...,p1_kM] } # p2 # , p1 def proximity(self, p1, p2): # in bool # self.edges[p1] p2 return p2 in self.edges[p1] 3.1.1.2. . class applied_topology(ost.Topology.Abstract): #, # p1 self.edges[p1] # p2 p1 self.edges = { p1: [p1_1,...,p1_k1] p2: [p2_1,...,p2_k2] ... pM: [pM_1,...,p1_kM] } # p # , p def neighborhood(self, p): return self.edges[p] . ...

97. http://nuclphys.sinp.msu.ru/conf/lpp14/Round%20Table%20Discussion/Spillantini.pdf

98. Photos

99. http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/9_11.pdf

100. http://brain.bio.msu.ru/papers/Kaplan_Shishkin_Ganin_Basyul_Zhigalov_2013_IEEE_TCIAIG__P300_BCI_games.pdf