1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... include stdio.h # include stdlib.h int main( int argc, const char* argv[]) { FILE* f; int c, wordCnt = 0, inWord = 0; if (argc 2) { printf ( Use: %s filename\n , argv[0]); return 1; } f = fopen(argv[1], r ); if (f == NULL) { printf ( Can't open file: %s\n , argv [1]); return 1; } while ((c = fgetc(f)) if (!isspace(c)) if (! inWord ) { ++wordCnt; inWord = 1; } } ... int main() { enum {RUNNING, STOPPED} state; state = RUNNING; state = STOPPED; } RUNNING STOPPED · : 1. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

• http://savenkov.lvk.cs.msu.su/mc/lect01.pdf

... While Russia is currently committed to solving the problems of the previous century, more prosperous countries are focusing on securing the prerequisites for global leadership in the 21st century on the basis of their own national interests.? ... One of their main responses has been a global competence mission through international education, and especially study abroad programs. ... Roughly 500,000 international students are currently studying in the United States at the postsecondary level. ...

Еще в разделе: (Показать все результаты (>78) - www.prof.msu.ru/ )

• Discovering America
• One effective method to turn passive students into active learners in Russian
• HUMAN RIGHTS AND DEVELOPMENT

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>156) - www.pereplet.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

Программирование диалогов 1. ... Написание диалоговой функции: float dedit = 0.; BOOL CALLBACK DialogProc (HWND hDlg ,UINT uMsg, WPARAM wParam ,LPARAM lParam) { char str [80]; switch (uMsg) { case (WM_INITDIALOG): sprintf( str , %5.2f , dedit ); SetDlgItemText( hDlg ,IDD_EDIT, str ); //CheckDlgButton( hDlg ,IDD_RED, TRUE ); return TRUE ; case WM_COMMAND: switch (LOWORD ( wParam )) { case IDOK: GetDlgItemText( hDlg ,IDD_EDIT, str ,80); //IsDlgButtonChecked( ...

Еще в разделе: (Показать все результаты (>26) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/science_education/lections/CS/cp/First.pdf

saved from the older version of mice .packageName 2) imputationMethod[j] 0 fullNames 0) stop(paste( Column , j, is used, has missing values, but is not imputed )) if(nmis[j] == 0 any( predictorMatrix [j, ])) { # warning(paste( Row ,j, of predictorMatrix is set to zero )) predictorMatrix [j, ] = 1 action 0] for(j in ind) { data [mis[, j], j] 1) { if( inherits (xj, ...

Еще в разделе: (Показать все результаты (>132) - herba.msu.ru/ )

• The variability of different Drosera
• The list of fotographs of expedition team members

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>5461) - monkey.belozersky.msu.ru/ )

• SDPpred
• Example of supporting positions
• SCOP famyli: Mismatch glycosylase

... Fellowship of Christian Athletes Scholarships . ... cheap ralph lauren . ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key Windows 7 key ultimate win 7 ultimate ...

Еще в разделе: (Показать все результаты (>313) - elana.sinp.msu.ru/ )

• cheap north face Gildan Activewear?s CEO Discusses Q2 2012 Results | С Днем
• editor | С Днем Победы!
• moncler outlet uk Holiday programming on TV starts this weekend | С Днем...

PHOTO GALLERY . ... 2013) . ... Thesis defence . ... After the defence . ... Reihstags (2013) . ... Parthenon (2013) . ... Greece (2013) . ... Germany (2013) . ... Moscow Region (1999) . ... Moscow . ... Moscow State University . ... View of Moscow . ... Moscow, Red Square . ... Scotland (2002) . ... Scotland . Bridge to the Future . Edinburgh Castle . London, Tower Bridge . Edinburgh Church . ... Ancient Rome Ruins . ... Rome (2005) . Rome, St. Peter's Church . Alps, Italy . ...

Еще в разделе: (Показать все результаты (>70) - polly.phys.msu.ru/ )

• History of Research - Chair of Polymer and Crystal Physics

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>2) - vserv.sinp.msu.ru/ )

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

... Consequently, weak fluctuations of the 1 growth rate concerning the M growth rate must necessarily generate strong fluctuations of the 2 growth rate. ... Statistics show that financial shocks occurred at positive values of ()(GDP). ... To test our hypothesis we consider correlation between TSec ­ an average annual growth rate of the market yield on U.S. Treasury securities at 1-year constant maturity ­ and ()-(GDP) over 1960-2009. ... Correlation between ()-(GDP) and the yields spread became...

Еще в разделе: (Показать все результаты (>18) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Kyvaldin_lecture_27062011.pdf
• http://www.mse-msu.ru/files/rossipr12.pdf
• http://www.mse-msu.ru/Bassanini_Mosca_rev4.pdf

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>44) - sn.sai.msu.ru/ )

... line .. ... line cable . ... Signal ACK NAK NOD ACN ACY ACW SINC DNG Hex. co de 0x87 0x96 0xA5 0xB4 0xC3 0xD2 0xE1 0xF0 Meaning Successful receiving of data Damaged packet was received Required data are not ready Command is successfully received but such a command do es not exist Command is successfully received and executed Command is successfully received but can not b e executed right now Synchronization signal Danger signal 29 Within the packet, the command byte follows after the header byte. ...

Еще в разделе: (Показать все результаты (>17) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf

. Voice Mosaic . Microphone Setup Module . To start microphone setup, press button and say a phrase "Testing microphone". The visual spectrum of a said command will immediately appear in the spectrum window: . Press button again. To return one step back, press button. When the command is repeated the required number of times, press button. See also: Training . Help Contents

Еще в разделе: (Показать все результаты (>57) - www.intsys.msu.ru/ )

• Training
• Intelligent Systems :: Research :: :: Articles

... 7.6 . ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• User's guide

... Написать комментарий . ... 22.09.2015 Спиральная галактика M96 от Хаббла . ... Конечно, M96 это спиральная галактика, и ее размер, включая слабые рукава, простирающиеся далеко за пределы центральной яркой области, превышает сто тысяч световых лет, что похоже на размер нашего Млечного Пути. ... Эта форма асимметричной тектонической активности, необычной для Земли, может дать новые данные о внутренней структуре Энцелада. ... 22.09.2015 Яркие пятна в кратере Оккатор на Церере разрешены . ...

Еще в разделе: (Показать все результаты (>64) - www.nature.web.ru/ )

. Fatal error : Can't use method return value in write context in /webs/cacs/system/application/modules/changepass/controllers/changepass.php on line 17 .

100. Название сайта