Program ODF3 is elaborated for numerical simulation of the EPR spectra and determination of the spectra parameters by fitting procedure. ... The examples of results obtained using ODF3 are presented in chapter "Simulation of rigid limit and slow motion EPR spectra for extraction of quantitative dynamic and orientational information" (in "Nitroxides - Theory, Experiment and Applications", ISBN 979-953-307-1090-0.) ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>136) - www.chem.msu.ru/ )

... QUANTUM INFORMATION AND COMPUTATION Absolute Robustness of the First Principal Fourier State Component and Noise Suppression in Hilbert Space Yu. ... 2, Moscow, 119992 Russia e-mail: skulik@qopt.phys.msu.su Received March 28, 2006 Abstract--The effect of the absolute robustness of the first principal Fourier-state component is developed upon rounding off the density matrix elements. ... This is interpreted as the absolute robustness of the first principal component of the Fourier state density...

Еще в разделе: (Показать все результаты (>127) - qi.phys.msu.ru/ )

• http://qi.phys.msu.su/papers/2008-pra-77-032336.pdf
• http://qi.phys.msu.ru/kulik/Papers/OS684.pdf
• http://qi.phys.msu.ru/papers/2010-prl-105-010404.pdf

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>96) - sai.msu.ru/ )

• Презентация PowerPoint
• GENERAL CATALOGUE OF VARIABLE STARS
• General Catalogue of Variable Stars: What's new.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>74) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/LasPhys10_03GrishaninLO.pdf
• http://qilab.phys.msu.ru/papers/LasPhys-2001-11(12)-en.pdf
• http://qilab.phys.msu.ru/papers/LasPhys-2000-10(6)-en.pdf

Еще в разделе: (Показать все результаты (>2) - www.womenmsu.msu.ru/ )

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>197) - ee-journal.spa.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Добавил в систему: Khokhlov . ... Dvorikova R.A. , Yu V.Korshak , Nikitin L.N. , Buzin M.I. , Shanditsev V.A. , Klemenkova Z.S. , Rusanov A.L. , Khokhlov A.R. , Lappas A. , Kostopoulou A. в журнале J. Characterization and Development of Novel Materials , том 2, ? ...

Еще в разделе: (Показать все результаты (>2233) - istina.msu.ru/ )

• Past and Present - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Terent?ev A.O. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Savelyev Evgenii N. - сотрудник | ИСТИНА - Интеллектуальная Система

... Russian: ps 2 pages . Published in: Russian Math. Surveys 57 (2002), no.3. ... English: ps (gzipped) 41 pages . ... Finitely presented groups and semigroups in knot theory. Russian: ps (gzipped) tex . English: ps (gzipped) tex . ... Russian: ps (gzipped) English: ps 20 pages . arXiv.org e-Print archive: http://arXiv.org/abs/math.RA/0205042 . ... Russian: ps English: ps 11 pages . ... In this paper we introduce and study gauge-equivariant $K$-theory groups $K_\GR^i(Y)$. ...

Еще в разделе: (Показать все результаты (>158) - higeom.math.msu.su/ )

• Publications (Russian)
• C*-algebras: Talks

... THE PARALLELIZATION OF COMPUTATIONAL ALGORITHMS IN LARGE PHYSICS PROBLEMS ON MULTIPROCESSOR COMPUTER SYSTEM CONTAINING THOUSAND AND MORE OF PROCESSOR ELEMENTS REQUIRES SPECIAL TOOLS. ... THE GENETIC ALGORITHM CAN BE CHARACTERIZED BY THE FOLLOWING PARAMETERS: - coding strategy, - population size, - initialisation strategy, - selection technique, - crossover mechanism, - mutation mechanism, - strategy for offspring inclusion. ... The results are presented on the following figure. ...

Еще в разделе: (Показать все результаты (>58) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/severyanov/Severyanov-poster.ps
• http://acat02.sinp.msu.ru/presentations/konash/Slides_ACAT2002.doc
• http://acat02.sinp.msu.ru/presentations/ratnikova/01.pdf

V.A. Morozov . Regularization Methods for Ill-Posed Problems . ... This monograph presents the theory and methods of approximate solutions of basic classes of ill-posed problems. It develops an abstract approach that is characterized by the following: widespread use of methods of functional analysis; concentration on general necessory and sufficient conditions of solvability and unique solvability of corresponding problems. The basic methods discussed is the methods of psendosolutions. ...

Еще в разделе: (Показать все результаты (>102) - srcc.msu.ru/ )

• V.B.Semikoz, D.D.Sokoloff, J.W.F. Valle, Lepton asymmetries and primordial
• Semikoz V. B., Sokoloff D., Valle J.W.F. Lepton asymmetries and primordial
• Kazakevich, Olga. Selkup warriors epics: present-day recordings // Congresus XI

... At the present time, the close collaboration between our countries in the fields of higher education, science, and culture is constantly expanding and becomes more stable. ... In accordance with the agreement between our Universities, in 1998 a special Russian-Mexican scientific program devoted to mathematical modeling of complex information processing systems was prepared. ... Mathematical modeling of information processes in neurophysiology . coordinators: Dr. E.Soto, Dr. T.B. Alexandrova) . ...

Еще в разделе: (Показать все результаты (>103) - num-anal.srcc.msu.ru/ )

LOMONOSOV MOSCOW STATE UNIVERSITY GEOGRAPHY DEPARTMENT RUSSIAN FOUNDATION FOR BASIC RESEARCH P.A. Kaplin, A.O. Selivanov Sea-Level Changes and Coasts of Russia: Past, Present, Future Moscow GEOS 1999 .. , .. : , , 1999 26.323 20 563.12 .., .. : , , . ... Global sea-level changes and sea coasts . ... General character of global sea-level changes in the pre-Pleistocene time . ... Global sea-level changes in the Pleistocene and Holocene . ... Global sea-level changes in the Late- and Postglacial time . ...

Еще в разделе: (Показать все результаты (>215) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/structure/labs/geos/personal/belova/Belova_2013_Pushchino.pdf
• http://www.geogr.msu.ru/structure/labs/notl/personal/Abstracts/Svitoch_QuaternaryInternational.2009.pdf
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,

ISSN 0027-1349, Moscow University Physics Bulletin, 2008, Vol. ... Application of Chaotic Mapping for the Encryption of Information A. Yu. Loskutov and A. A. Churaev Department of the Physics of Polymers and Crystals, Faculty of Physics, Moscow State University, Leninskie gory, Moscow, 119992 Russia e-mail: Loskutov@chaos.phys.msu.ru Received May 30, 2007 Abstract--A new method previously proposed [1] for the encryption of information by means of chaotic mappings is studied in detail. ...

Еще в разделе: (Показать все результаты (>69) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/PHDK634.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/JCTE1358.pdf

... 2 : 1 ­ , 2 ­ : 1 : 1) Define the subject of intercultural communication. What is the difference between intercultural and cross-cultural communication? ... 2) Define culture. ... Explain the role of metaphor in culture studies. ... 4) Enumerate the basic functions of culture. ... 13) Comment on the acute problems of intercultural communication in the modern Russian society 2 : 1) Was Edward Hall right to define communication as culture and culture as communication? ... 2) Define communication. ...

Еще в разделе: (Показать все результаты (>62) - ffl.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The revision of the MASS/DIMM star catalogue N. Shatsky, V. Kornilov March 16, 2008 Abstract The compilation of the (updated) version of the MASS (MASS/DIMM) device target catalogue is described. ... Then the list was cleaned according to following criteria: I. Remove stars too faint for a MASS device. ... Here the color equation of the Sternb erg device was taken: M AS S mag = V mag + 0.45 (B - V ); stars with M AS S mag > 3.2 were removed. ... This was made based on the GCVS4.2 catalogue data. ...

Еще в разделе: (Показать все результаты (>19) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/pmt_param_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf

... Functional coupling between nucleoside diphosphate kinase of the outer mitochondrial compartment and oxidative phosphorylation. ... In all three systems, muscle creatine phosphokinase was the external agent competing with the oxidative phosphorylation system for ADP. ... It is concluded that oxidative phosphorylation is accompanied by appearance of functional coupling between mitochondrial nucleoside diphosphate kinase and the oxidative phosphorylation system. ...

Еще в разделе: (Показать все результаты (>86) - biochem.bio.msu.ru/ )

• Structure and properties of chimeric small heat shock proteins containing
• Cardioprotective effect of histidine-containing dipeptides in pharmacological
• Effect of colchicine on sensitivity of duck salt gland Na,K-ATPase to Na+.

... Женский клуб . ... Издательство МГУ . ... Сотрудники Университета Лаваль, Университетского госпиталя Квебека и компании GlaxoSmithKline заявляют: им удалось подойти вплотную к получению вакцины против болезни Альцгеймера, пишет The Best medical cover . Ученые выделили молекулу MPL, на которую они, как раз, делают основную ставку. ... The molecule, known as MPL (monophosphoryl lipid A), has been used extensively as a vaccine adjuvant by GSK for many years, and its safety is well established. ...

Еще в разделе: (Показать все результаты (>175) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC
• Клуб выпускников МГУ: Три тысячи продуктов для продления молодости

OldFonts FONT PACKAGE The package gives a LaTeX user access to several traditional Russian font families used for book typesetting. ... Fonts contain modern Russian characters as well as those used in the 19th century Russian writing. The package also contains supplementary files that allow use of "Adobe Minion Pro" and "Palatino Linotype" font families with LaTeX. ... So all documentation is written in Russian. ... A.V.Dmitriev, 4 June, 2006. http://lizard.phys.msu.su, http://lizard.phys.msu.ru ...

Еще в разделе: (Показать все результаты (>17) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/compu_sci/oldfonts-eng.html