On this page: . ... Events . ... A call to $(foo).dialog() will initialize a dialog instance and will auto-open the dialog by default. If you want to reuse a dialog, the easiest way is to disable the "auto-open" option with: $(foo).dialog({ autoOpen: false }) and open it with $(foo).dialog('open') . ... This will initialize the following css classes to build the dialog widgets: . ... This event is triggered when dialog is created . ... This topic: System > JQueryPlugin > JQueryUIDialog . ...

Еще в разделе: (Показать все результаты (>1477) - wiki.cs.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>151) - www.pereplet.ru/ )

... About lab . ... This project is dedicated to enhancement of microscopic images and related problems in order to simplify further analysis (by human or by computer) of such images. ... However, images acquired using described system, have a number of drawbacks, such as limited dynamic range of luminance or limited depth of field. ... The sharpest parts are selected from different images and combined together on resulting image with extended depth of field (see pic. ... Pic. ...

Еще в разделе: (Показать все результаты (>63) - graphics.cs.msu.ru/ )

• Digital Microscope | Лаборатория компьютерной графики и мультимедиа

... Географии мирового хозяйства . ... gucci bags review or kem bags . ... I prior to now being allowed to see twitting get the latest to chanel handbags online texts coach handbags outlet stores but more wikipedia current just how the most up to date grandma make vacuum freezer bags birkenstock celtics a husky, a bit planted regarding welcomes domain, gucci travel bag so a large amount of the required grows could also be sizeable-evening as you would expect (penning buy gucci ...

Еще в разделе: (Показать все результаты (>117) - www.geogr.msu.ru/ )

• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• bbpgp

. Home . 09 / 04 / 2016 . QFTHEP . Home . News . Bulletins . Programme . QFTHEP Poster . Sponsors . Proceedings . Archive . QFTHEP'2013 . QFTHEP'2011 . QFTHEP'2010 . QFTHEP'2004 . QFTHEP'2003 . QFTHEP'2001 . QFTHEP'2000 . QFTHEP'1999 . QFTHEP'1997 . User Menu . Login/Logout . QFTHEP'2015 .

Еще в разделе: (Показать все результаты (>86) - qfthep.sinp.msu.ru/ )

The name of film studio "Eh-Film" should be understood as phonetical reverberation of two key letters in ElectroChemistry. ... Academician Frumkin arrives to his Dept in Moscow University (usually he had spent two days at the Dept, and other days were devoted to his Institute). Staff is waiting for Frumkin in his office, and disappear from the office when Frumkin approaches the Dept. ... Finally Frumkin proposes the student to continue his experimental work for two weeks. ...

Еще в разделе: (Показать все результаты (>38) - electr003.chem.msu.ru/ )

• Theory as a Lighthouse in the Electrochemical Ocean

2009 BASIC IP2 WIN TUTORIAL Basic Principles in Using IP 2 Win Software Alva Kurniawan Hydrogeology World alvathea.wordpress.com BASIC IP2 WIN TUTORIAL Basic Principles in Using IP2 Win Software ALVA KURNIAWAN © HYDROGEOLOGY WORLD 2009 Foreword Nowadays we are entering and living in a digital era where most of our activities are being helped by digital equipment. ... 5 Next click File>New VES point like the picture above. ... 13 Close IP2 Win software by clicking File>Exit. ... 15 Click File>Open. ...

Еще в разделе: (Показать все результаты (>43) - geophys.geol.msu.ru/ )

• Anis. Page2
• TES tecnology. MSU.

... In December 2004 in order to help being oriented correctly in the world of High Performance Computing systems and to have the possibility to operationally track the development trends in this area, Joint Supercomputer Center of the Russian Academy of Sciences and Research Computing Center of Moscow State University started a joint project тАЬTop50 list of the most powerful supercomputers of the CISтАЭ. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>11) - hpc.msu.ru/ )

... О UNИX . ... Неизменяемая страница . ... Processing Instructions . ... redirect . ... pragma . ... deprecated . ... MoinMoin processing instructions have the same semantics as in XML: they control the paths taken when processing a page. ... For more information on the possible markup, see HelpOnEditing . Processing instructions MoinMoin knows of: . ... Redirect to a different page (see PageRedirect ) #REDIRECT pagename . ... Sets processing modes for this page: #PRAGMA mode arguments . ...

Еще в разделе: (Показать все результаты (>88) - uneex.mithril.cs.msu.su/ )

• HelpOnInstalling/ApacheWithModPython - UNИX
• HelpOnParsers/ReStructuredText/RstPrimer - UNИX
• HelpOnImages - UNИX

... Home > Department of Algorithmic Languages . Head of the department: Mikhail G. Malkovskiy, Professor, Dr.Sc. ... Vladimir G. Abramov, Associate Professor, PhD, Scientific Secretary of the Department . ... Algorithms and Algorithmic Languages by Prof. Solovyev, 54 lecture hours and 72 seminar hours, 1st semester. ... Prof. Bordachenkova, 48 lecture hours and 64 seminar hours, 2nd semester. ... Prof. Volkova and Dr. Vylitok, 46 lecture hours and 60 seminar hours, 4th semester. ... Prof. Abramov. ...

Еще в разделе: (Показать все результаты (>64) - en.cs.msu.ru/ )

... Executive MBA programs have kept their popularity among high-ranking businesspeople in Russia, despite the economic crisis. ... The Chicago School of Business created the first EMBA program in 1943, and more than 300 programs now exist worldwide, according to the Executive MBA Council, an international business education association. ... Even when the EMBA program uses the same business cases as the MBA offering, Boltrukevich said, the education s different because the group of students is different...

Еще в разделе: (Показать все результаты (>15) - www.mgubs.ru/ )

Program H2O-H2S-NaCl User manual About the software 1 Program installation 1 Files and folders 1 Creating data files 2 User interface of the H2O-H2S-NaCl program 2 Initial data 2 Computation results 3 Working with H2O-H2S-NaCl program 3 Additional Comments 4 References 4 Appendix. ... Working with H2O-H2S-NaCl program Program's interface implies switching between the program window with its control items and the Excel workbook with the initial data and the computation results. ... the xls data file | ...

Еще в разделе: (Показать все результаты (>35) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/GibbsExt.doc

LOESS IN ARGENTINA: TEMPERATE AND TROPICAL (Report on the International Joint Field Meeting of the INQUA Loess Commission and Climates of the Past (CLIP) in Argentina). ... This field meeting, organised by Martin Iriondo and his co-workers, went from the heart of the Pampa (Carcara ? a basin, Santa Fe province) to the very north-eastern end of Argentina (the Iguazu falls), crossing the provinces of Entre Dos Rios, Corrientes and Misiones. ... Organization of this meeting was perfect. ...

Еще в разделе: (Показать все результаты (>89) - www.fadr.msu.ru/ )

• Klumpen—a Mesoscale Level of Classification for Soil Structure: Rationale
• the paleopedology working group had a conference last year in Mexico on "Global
• Abstracts

... The legs didn?t ride up high, plenty of shorts get. ... Mixing and matching layers and turning shirts into dresses have the ability to belts are not the same ways things whole new outfits, . ... 7) Turn the radio off. Unless you?re scoping out the sound system, leave the radio off. Is actually why so frequency higher any unusual noises. Maybe even turn the A/C on and off and search for noises there as excellent. ...

Еще в разделе: (Показать все результаты (>47) - elana.sinp.msu.ru/ )

• cheap moncler developed by examiners through their skills and expertise | С

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf

Effective Algorithm of Charge State Determination in Electrospray Ionization Fourier Transform Ion Cyclotron Resonance Mass Spectra of Humic Substances Erast V. Kunenkov1, Andras Gaspar2, Alexey S. Kononikhin3, Philippe Schmitt-Kopplin2, Irina V. Perminova1 ... ESI FTICR mass spectrum of HS contains about ten thousands of peaks in mass range 250­1200 Da (the most intensive peaks are usually located near 400 Da) with tenths of peaks, appeared at each nominal mass with high regularity. ...

Еще в разделе: (Показать все результаты (>102) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2002/hertkorn-comparative-02.pdf

. Prague, August 16, 2006 . Present classification : Suggested: RPHS RPHS (rapidly pulsating hot subdwards; we repeat our call for suggestions of a better designation) . LPB or LBV SPB . PULSATING VARIABLES (CONTINUED)

Еще в разделе: (Показать все результаты (>70) - sai.msu.ru/ )

... 322, 347­351 (1997) ASTRONOMY AND ASTROPHYSICS The solar eclipse observed by Clavius in A.D. 1567 F.R. Stephenson1 , J.E. Jones2 , and L.V. Morrison 1 2 3 3 Department of Physics, University of Durham, DH1 3LE, UK Proudman Oceanographic Laboratory, Bidston Observatory, Birkenhead, Merseyside, L43 7RA, UK Royal Greenwich Observatory, Madingley Road, Cambridge, CB3 0EZ, UK Received 14 June 1996 / Accepted 17 September 1996 Abstract. ... The solar eclipse observed by Clavius in A.D. 1567 (a) 42. ...

Еще в разделе: (Показать все результаты (>71) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/ahist/antikythera2.pdf
• Robert R. Newton, The Secular Acceleration of the Earth's Spin
• The Work of Velikovsky

... New Approach to the Defibrillation Problem: Suppression of the Spiral Wave Activity of Cardiac Tissue A. Yu. ... It is shown that a weak external point action on such a medium leads to the suppression of all spiral waves and, correspondingly, to the stabilization of the system dynamics. ... Thus, the most favorable frequencies for suppression are external-action frequencies at which the frequency of circular waves excited by them is close to the maximum possible value for given medium parameters. ...

Еще в разделе: (Показать все результаты (>56) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/JPA_destochastization.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/CHAOS_DNA.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf

... The circular sidewall of the layer was made of plexiglass. ... This is in contrast to the situation of horizontal layer where longitudinal magnetic field doesn't influence on convective instability and only renders oriented effect [8,10]. [ pic ] Figure 6 Stability boundaries of thermally driven shear flow in an inclined ferrofluid layer in the presence of a longitudinal magnetic field : a - shear flow ; b - convection rolls aligned with the shear flow ; c - convection ...

Еще в разделе: (Показать все результаты (>9) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2006/CD/BozhkoAAPutinGF.pdf