function [result] = scheme2System( fileName ) links = zeros(100, 100); function [n] = getBlockNum(BlockName) n = -1; for i = 1:size( blocks ,2) if( strcmp (BlockName, blocks (i). name ) ) n = i; return; end end end function makeLinks( src ) s = fgets (f); while ~ strcmp ( strtok (s), '}') [s r] = strtok (s); if( strcmp (s, 'Branch')) makeLinks(src) elseif( strcmp (s, 'DstBlock') ) r = strrep (r, ' ', '');% ...

Еще в разделе: (Показать все результаты (>3) - ndsipu.cmc.msu.ru/ )

... P ast C S et. e C P aste = {e C : e e} н , e, e1 e2 P aste1 e2 : P aste1 P aste2 , . P ast [2] . ... S etC . ... Loc P ast [2] . ... 13): (мLo c)e = {w W : e , (мLo c = ) (e C w W P aste w = ). 3.2. мLo c . ... Glob (4) [Loc ] : Glob , [Loc ]e (w) = df [F ] (30) (31) {(e e) M orC (§, e) : e w}. e, , , e , , w. e w, (31) e н , P aste w = , (31) () н . ... e e0 {(e e) M orC (§, e) : Lo ce Lo ce0 = }. 8 (33) (32) Loc Lo ce0 , Lo ce0 : [Lo ce0 ]e = Lo ce0 e. , e0 e, (33) e. , (33) , P aste e0 . ...

Еще в разделе: (Показать все результаты (>201) - chronos.msu.ru/ )

• Ильичев Л. В. (Il'ichov L. V.)
• Russian Interdisciplinary Temporology Seminar

An annotated checklist of the insectivores (Mammalia, Lipotyphla) of Vietnam . Abramov A.V., Dang Ngoc Can, Bui Tuan Hai Nguyen Truong Son . P. 57-70 . An annotated checklist of 32 extant species from 12 genera of the insectivores (Mammalia, Lipotyphla) of Vietnam is provided. ...

Еще в разделе: (Показать все результаты (>573) - zmmu.msu.ru/ )

• RBR homepage
• Types Database
• XIV International Ornithological Conference of North Eurasia: Organizers

Femtosecond Time-Resolved Transverse Kerr Effect Measurements in Magnetoplasmonic Crystals A. Yu. ... Application of external magnetic field to a magnetic medium causes alteration of reflected light amplitude that is so-called magneto-optical Kerr effect. ... For example, excitation of surface plasmon polaritons (SPP) in a magnetized sample by femtosecond laser pulses can lead to time moduation of magneto-optical transversal Kerr effect (TKE) intensity that differs from its steady-state value. ...

Еще в разделе: (Показать все результаты (>36) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/pe14_abstracts.pdf
• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

ICASS VI Programme Session 06.02: World history of the last century reflected in life stories of autochthonous minorities in the North 23.08.2008 Chair: Kazakevich, Olga; Lomonosov Moscow State University; Russia Co-Chair: Burkova, Svetlana; Institute of Philology, Russian Academy of Sciences, Siberian branch; Russia 1. ... Koshkareva, Natalya; Institute of Philology, Russian Academy of Sciences, Siberian Branch; Russia 3. Changes in Russia in 1920-50s through Forest Nenets Life Stories . ...

Еще в разделе: (Показать все результаты (>13) - lcl.srcc.msu.ru/ )

• ЛАБОРАТОРИЯ АВТОМАТИЗИРОВАННЫХ

Title Author Key words TV as a factor of children's exposure to domestic violence Lebedeva V.A. violence, children's exposure to domestic violence, physical violence, psychological violence The article elucidates the problem of children's exposure to domestic violence and the influence of television to its formation in modern Russia. ...

Еще в разделе: (Показать все результаты (>18) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/3/03.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2015/1/08.pdf
• Вестник МГУ

... айзйлоЦкД дДд игДбеЦззхв йЕцЦдн ї Ц ЫiЛПУ, г.е., 1998 - ( ) , - . ... 100 , Bi in , . ... 4) , (B ) (V V ) , a V d = c [ E Ч b ] / B , b = B / B. ЦкмпаейЗ г.е. айзйлоЦкД бЦега дДд дйлеауЦлдДь игДбеЦззДь гДЕйкДнйкаь 73 C (3)-(5) F = - grad P , P = NT ( = 1,38 Ч Ч 10- 16 / - , grad P = = ( P ( r 1 ) - P ( r 2 ) ) / ( r 1 - r 2 ) r ). , , . ... 2, PB e E -1 P + P W = N T i + T e + --------------- ( 1 + 1 ) = const. (10) 2 m 2 2 ЦкмпаейЗ г.е. айзйлоЦкД бЦега дДд дйлеауЦлдДь игДбеЦззДь гДЕйкДнйкаь 75 () ...

Еще в разделе: (Показать все результаты (>12) - www.kosmofizika.ru/ )

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>60) - sp.cs.msu.ru/ )

• Fortran DVM - Language for Portable Parallel Programs Development
• Explicit cyclic schemes for space neutron kinetics in (Hex-Z) geometry
• C-DVM compiler. User's guide

. Photographers: Yuri Artukhin . scientist in a staff of Institute of Ecology and Land use, Kamchatka branch . Alexander Ladyguin . in a staff of Moscow State University Science Park . Alexey Mazlov . scientist in a staff of Pacific Salmon Institute . Vitaliy Nikolaenko . scientist in a staff of Kronotskiy State Biopsphere Reserve . Archive | Publications | Projects | Authors . Contacts | Russian .

Еще в разделе: (Показать все результаты (>69) - www.fadr.msu.ru/ )

• Фотоархив "EcoPhoto" - Публикации
• "EcoPhoto" - Publications
• IV International Conference on Cryopedology

... Dubna & our Venue . ... Dubna branch of the Skobeltsyn Institute of Nuclear Physics, Moscow State University . ... Dubna is located 120 km north of Moscow on the Volga river banks. ... The trains from Moscow to Dubna depart from Savelovsky railway ("Savelovskaya" metro station). there are two railway stations in Dubna: station "Bolshaya Volga" and terminal "Dubna". ... There are two railway stations in Dubna: station "Bolshaya Volga" and terminal station "Dubna". ... from station 'Dubna' . ...

Еще в разделе: (Показать все результаты (>4) - www.elch.chem.msu.ru/ )

... Conference Venue . ... Kirk Hatfield University of Florida, Department of Civil and Coastal Engineering, Gainesville, USA . ... Irina V. Perminova Co-Chair of Organizing Committee, Department of Chemistry, Lomonosov MSU, coordinator of the CIS IHSS chapter . ... Olga Yakimenko Conference Secretary, Department of Soil Science, Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>50) - mgumus.chem.msu.ru/ )

... Your girlfriend is ... than George's. much more beautifuler . ... Much of London ... by fire in the seventeenth century. destroyed . ... John prefers .... travelling by air to travelling on train . ... English, this year he .. ... Yesterday I bought a ... shirt. white new cotton . ... The professor said that .... the students can turn over their reports on Monday . the reports on Monday could be received from the students by him . the students could hand in their reports on Monday . ...

Еще в разделе: (Показать все результаты (>4) - anazarenko.ffl.msu.ru/ )

surface science . ... Time resolved techniques (2007), http://www.nobelprize.org/ nobel_prizes/chemistry/laureates/ 2007/ertl-lecture.html Loading = «» (.% /2 .) (specific) : 2 /«» «» ( ) () O.M., B.C. .- ... NADH 10 J Amer Chem Soc 131 92009) 17412-17422 mM (--) - C. R. Physique 9 (2008) 78­94 PANi 3,4-- (EDOT) 0 10 -16 10 -8 10 10 8 , / ? ... Chem. 78 (2006) 3490 ­ (tilt angle) ( ) ( ) Surface Sci. ... Surface Sci. ... 1 (2006) 173 - «» - XPS Langmuir 19 (2003) 3720 Nano Lett 8 (2008) 1 ( ) Chem. ...

Еще в разделе: (Показать все результаты (>38) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/asp2/b3L1.pdf

... Authors: M. A. Nowak et al. arxiv:1209.4524 Первая спектроскопически разрешенная орбита пары сверхмассивных черных дыр (The First Spectroscopically Resolved Sub-parsec Orbit of a Supermassive Binary Black Hole) . ... Authors: B. Mosser et al. arxiv:1209.1354 Обнаружение активной сверхмассивной черной дыры в безбалджевой галактике NGC 4561 (Discovery of an active supermassive black hole in the bulge-less galaxy NGC 4561) . ... обзор arxiv:1209.2509 Первые звезды (The First Stars) . ...

Еще в разделе: (Показать все результаты (>88) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1210.html
• Новости науки

The first major global tomographic study was made by Professor Dziewonski in early 70's. The idea of this study was that the travel time anomalies observed for many ray paths, criss-crossing the Earth between various points near the Earth's surface and reaching different depths in its interior, could be resolved formally into a three-dimensional (3-D) model. ... How to use Harvard's 3-D Earth models? Now, you can download source codes in order to use Harvard's recent Earth models. ...

Еще в разделе: (Показать все результаты (>130) - geo.web.ru/ )

• Александр Розенбаум - "Спокойной ночи"

... This family contains a protein with resolved 3D structure: Q8UK99_AGRT5/3-102 , pdb ID: 1vqy . SDPsite predicts following important positions (numbering corresponds to 1vqy ): . ... 90S, 55W . ... 76W, 8Y, 46G, 55W, 39G, 63R . ... 8Y, 39G, 55W, 63R, 76W, 90S . ... Mapping predictions onto structure of 1vqy : . Associated grouping: . Group 1 . Q7ZWJ6_BRARE/154-253 . Q6DJ76_XENTR/154-253 . ... NPS3B_HUMAN/146-245 . ...

Еще в разделе: (Показать все результаты (>140) - bioinf.fbb.msu.ru/ )

• SDPsite - PF01205
• SDPsite - PF01206
• SDPsite - PF01171