To make visas please contact Olga I. Yakovenko . ... Date of birth: . ... Date of issue: . Date of expiration (your passports must be valid 3 months after the end of the sojourn in Russia): . ... Date of arrival in Russia: . Date of leaving Russia: . Single or multiple visa: . ... Location of the consulate where you will obtain the visa*: *) You are not obliged to come in the central Russian Consulate in your country for obtaining your visa. ... Visas to Russia . ... Information . ...

Еще в разделе: (Показать все результаты (>7) - seac47-2.phys.msu.ru/ )

... Each year about 25 new students (3rd year of education) who want to have special education not only in chemistry but also in life sciences join our department. ... They can choose one of two specializations: Physical Chemistry of Enzymes or Enzyme (Protein) Engineering. ... There is a new lecture course for all students studying at the Faculty of Chemistry concerning Chemical outlook to life sciences given by Prof. S.D.Varfolomeev. ... Enzyme kinetics (4th year of education) (Prof. A.V.Levashov). ...

Еще в разделе: (Показать все результаты (>53) - www.enzyme.chem.msu.ru/ )

• Personal page of professor Vladimir Tishkov
• Research Group of Biochemistry of Fibrinolysis"
• Members of Genetic and Protein Engineering Group

... Laboratories: . Inorganic Materials Sciences . ... Inorganic Synthesis . Inorganic Crystallochemistry . Laboratory people: . ... Al yo shin V ladimir A. Assoc . Prof . Dr. Sci . ... 7(495)939-1200 . Ardashnikova E lena I. Assoc . ... Ph.D . ... 7(495)939-5502 . ... Vice Head of the division . ... Assoc . ... Assist Prof. Ph.D . ... Vice Head of the division, Vice head of the laboratory . ... Shevelkov Andrei V. Professor, Head of the division, Head of the laboratory , . ...

Еще в разделе: (Показать все результаты (>5) - www.inorg.chem.msu.ru/ )

• Inorganic Chemistry Division
• Joint Semiconductors Surface Study group
• Staff listing - Inorganic Chemistry Division - Chemistry Department - Lomonosov

... THE LJUBLJANA SUMMER SCHOOL 2006 . ... THE LJUBLJANA SUMMER SCHOOL 2006 is a new intensive programme open to both undergraduate and graduate students of Business, Economics, and other fields of Social Sciences. The programme was created at the Faculty of Economics in Ljubljana in order to impart knowledge by taking full advantage of our country s unique geographical position: the meeting point of East and West. ... The Summer School s aim is to learn by applying knowledge to real-life situations. ...

Еще в разделе: (Показать все результаты (>20) - www.mgubs.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

Moscow University ] [ Brain Research Group ] . ... Alexander Yu. Zhigalov Ph.D. in Psychophysiology, M.V.Lomonosov Moscow State University, Russia, 2009 . thesis: "A study of human EEG alpha activity dynamics in the brain computer interface loop" . advisor: Prof. A.Ya.Kaplan . ... Kaplan A.Ya., Zhigalov A.Yu. The dynamic of human EEG alpha-activity in the loop of brain - computer interface during trigger photo stimulation. ... In Russian) . ... Levichkina E.V., Zhigalov A.Yu. ...

Еще в разделе: (Показать все результаты (>28) - brain.bio.msu.ru/ )

... Полная версия: Продам новое платье латина Ю1 . Грация-МГУ::Форум > Дискуссии > Танцевальная жизнь > Товары & услуги . Валентина . Mar 17 2012, 15:41 . Продам новое платье латина Ю1 рост 145-150. ... 8499 743 71 71 Валентина. фото никак не могу пока разместить http://dmir.ru/obyavleniya/prodam-plate-la...&position=1 . Это текстовая версия - только основной контент. Для просмотра полной версии этой страницы, пожалуйста, нажмите сюда . ...

Еще в разделе: (Показать все результаты (>4) - grace.msu.ru/ )

Biography of Lawrence Douglas Wilder Former Virginia Governor L. Douglas Wilder became Richmond's new mayor on January 2, 2005, following his election by an overwhelming majority of voters. ... Mr. Wilder became the first AfricanAmerican to be elected governor in the U.S., leading the Commonwealth of Virginia from 1990 to 1994. ... Serving as a state senator representing Richmond from 1969 to 1985, Mr. Wilder became the first African-American state senator in Virginia since Reconstruction. ...

Еще в разделе: (Показать все результаты (>38) - hist.msu.ru/ )

• The Rise of Cooperative System: Ascents and Descents (1860s - the midst of
• "Novaya i noveishaia istoria" Journal

Your Marketing Strategy Canada Business Service Centres - CBSCs 1. ... List your service(s) or product(s) . ... Personal Selling o Evaluate Media, Vehicles (Strengths/Weaknesses) o Target Market Analysis o Cost Advertising o Which media best reaches your customers? o When should you advertise? o How much should you spend? o How often should you advertise? o What should you advertise? o Cost/Benefit analysis Sales Promotion o What type of sales promotion should you do? o What form should it take? ...

Еще в разделе: (Показать все результаты (>13) - innovation.msu.ru/ )

• Start-Up Company Development :: Управление инновационной политики и организации

... LEXICOGRAPHY . ... Research . ... 1976 – current: Moscow State University . Scientific Research Computer Center . Currently – Computer Programmer . ... Moscow State University . ... Department of Structural and Applied Linguistics. Research Interests . Lexicography. ...

Еще в разделе: (Показать все результаты (>17) - lcl.srcc.msu.ru/ )

.. . .. · · « » · · , . · ( ), ­ . · ( ­ - ). · ( , conveying machines), () . · · ( ­ ­) (­ ) , · , , · -, · , · - - , · . · C ( ) · 1) ­ : · , · , . · 2) , · ­ : · , , , , . · 3) : · , · . · , , · . · , . · ( ) . . - - 70S V.Ramakrishnan, Nature, October 29, 2009 in vivo. . 30S 50S . © 2009 Nature Publishing Group. Published by Nature Publishing Group. Ratchet movement can cause the helices rotation that changing the GAC position 2058 . . . 2009 .. . ..

Еще в разделе: (Показать все результаты (>3) - nano.msu.ru/ )

• http://www.nano.msu.ru/files/seminars/prospects/Bukhtiyarov_CV.pdf

... TTDock: a docking method based on tensor train decompositions" . Zheltkov D.A., Oferkin I.V., Katkova E.V., Sulimov A.V., Sulimov V.B., Tyrtyshnikov E.E. A new docking method based on tensor train decomposition is proposed. ... Zheltkov D.A., e-mail: dmitry.zheltkov@gmail.com тАУ Moscow State University, Faculty of Computational Mathematics and Cybernetics; Leninskiye Gory 1-52, Moscow, 119991, Russia; . ...

Еще в разделе: (Показать все результаты (>25) - num-meth.srcc.msu.ru/ )

• "Virtual dimensions in the docking method based on tensor train decompositions"
• "A problem of synthesis of nano-optical elements for the formation of dynamic
• "Nonuniqueness of shockwave structures in real gases: the Mach and/or regular

... Home News Colloquium on 10.04.08 . ... Voskov A.L., Uspenskaya I.A. "The phase diagram Cu-Gd calculation" . Nikolaeva L.S., Semenov A.N., Mamontov M.N., Feofanova M.A. "Calculation of chemical equilibria in the systems CaCl 2 -heparin-adenosine triphosphate and MgCl 2 -heparin-adenosine triphosphate inљthe physiological solution medium". ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

94. http://www.elch.chem.msu.ru/mole/lecture/qsavinova.pdf

95. http://www.paleopedology.msu.ru/discussions/messages/42.html

96. http://www.msm.biophys.msu.ru/archive/doc15122/eng.pdf

97. Supernova 1999br in NGC 4900

98. Daniil A. Shilkin | Laboratory of Nanophotonics & Metamaterials

99. http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2011/Kudryavtsev_Bruevich_en.pdf

100. http://www.chem.msu.ru/eng/misc/babaev/papers/003e.pdf