... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>123) - kodomo.fbb.msu.ru/ )

Proteogenomic analysis of bacterial signal peptides Dmitry N. Ivankov1, Samuel H. Payne2, Stefano Bonissone3, Si Wu4, Roslyn N. Brown2, Ljiljana Pasa-Toli4, Matthias Birschenk5, Iris ... Department of Genome-Oriented Bioinformatics, Technische UniversitДt MЭnchen, Freising, Biological Sciences Division, Pacific Northwest National Laboratory, Richland, WA, USA ; Bioinformatics Program, University of California San Diego, La Jolla, CA, ... 2013) How many signal peptides are there in bacteria? ...

Еще в разделе: (Показать все результаты (>53) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/4.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/120.pdf

Moscow 2013 16th Lomonosov Conference Particle Accretion onto Miniholes Michael L. Fil'chenkov Yuri P. Laptev Institute of Gravitation and Cosmology, Peoples' Friendship University of Russia, Moscow 1 Moscow 2013 16th Lomonosov Conference Outline · Introduction · Classical Accretion onto Black Holes · Quantum Hydrodynamics · Quantum Accretion on The total luminosity of the accretion disc and the energy of quanta being emitted have been calculated. ...

Еще в разделе: (Показать все результаты (>26) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Fil'chenkov.pdf

e-mail: lbronzino@gmail.com) , , " ", , " ", , , personal knowledge, tacit knowledge, "knowledge archaeology", subjectivity, "tacit knowledge", social cognition, methodology " " . ... According to M. Foucault, the "archive creation" may emerge as the missing element which can make up for the model of social cognition in which tacit knowledge will be expressed whereas Foucault integrates different practice patterns ­ first and foremost, knowledge and power ­ to create "knowledge archaeology". ...

Еще в разделе: (Показать все результаты (>5) - vestnik.socio.msu.ru/ )

You are here: Foswiki > System Web > JQueryPlugin > JQueryLoader (24 Oct 2011, ProjectContributor ) E dit A ttach . ... This plugin allows to delay rendering parts of a page that are loaded later on asynchronously and patched into the page. ... Then add the jqLoader css class to the div (or verbatim) element which will serve as a container for the content to be loaded. Any jqLoader container requires either an url or a section parameter to specify the location from where to load the content. ...

Еще в разделе: (Показать все результаты (>84) - wiki.cs.msu.ru/ )

... Academic Departments . ... Partners . ... All partners . ... 02.12.2013 . Andrei Richter "The notion of freedom of (the media) in international law and policy" . ... Hannu Nieminen "Changes in the Regulatory Framework of Media and Communications: Four Explanatory Strategies and Six Researcher Profiles" . ... Awarding the titles of Honorary Professors of the Faculty of Journalism, Lomonosov Moscow State University: . ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>12) - www.journ.msu.ru/ )

• Lecture of Alexander Laskin :: Department of Journalism, M. V. Lomonosov Moscow

... IUPAB) 28 ­ 2 2007, . IUPAB -. Ian C.P. Smith Ian C.P. Smith () () Henrik Flyvbjerg () () () () () () Joe Tien () () () () Erik Mosekilde () Leonardo Masotti () Michael Andre () () John Connally () ( ) () () Aaron Fenster () () Latchezar Avramov () Sylwester Sommer () Andrzej Wojcik () Stanislav Kozubek () Radostina Georgieva () 800. : ­ 1 2007, ­ 28 2007 http://www.msm.biophys.msu.ru dubna2007@biophys.msu.ru . 939-19-66 ...

Еще в разделе: (Показать все результаты (>6) - www.msm.biophys.msu.ru/ )

• Modern spectroscopy methods

The Chair of Mathematical Theory of Intelligent Systems and . ... of Moscow State University Official Website . ... Staff . ... Alexander Borisovich Kholodenko was born on November 15, 1976 in Moscow. ... Alexander Kholodenko graduated from the Faculty of Mechanics and Mathematics in 1999 as a student in mathematics and in 2002 as a post-graduate student in mathematics. ... Kholodenko A.B. About the creation of statistic language models for Russian speech recognition systems. Intelligent systems. ...

Еще в разделе: (Показать все результаты (>34) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Safiullin Alexander Naifovich
• Intelligent Systems :: Staff :: Andreev Alexander Egorovich
• Intelligent Systems :: Staff :: Kudrin Alexander Alexandrovich

MOSCOW STATE UNIVERSITY -- Faculty of Biology -- Department of Human Physiology -- . ... Our interest is the secret springs of work of a brain. How can a new idea be born in the brain if the physical environment remains constant? ... What mechanisms of the brain are broken in schizophrenia? ... For this purpose we create brain-computer interfaces (BCI) based on modern methods of computational electroencephalography. ... Department of Human Physiology . ... Former Visitors . ... Former students . ...

Еще в разделе: (Показать все результаты (>32) - brain.bio.msu.ru/ )

• Alexander Kaplan * Александр Каплан
• Nonparametric approaches to the description of EEG piecewise stationary
• Alexander Zhigalov

Laboratory of Microfluidics and Nanofluidics . Laboratory of Physical Chemistry of Modified Surfaces . ... Russian Academy of Sciences . ... Martin Z. Bazant , MIT, USA . Lyderic Bocquet , Univ. Lyon, France . Francois Feuillebois, ESPCI, France . Jens Harting , Univ. ... Martin Moller , RWTH Univ. Aachen, Germany . Friederike Schmid , Univ. Mainz, Germany . Gleb B. Sukhorukov , Univ. ... Fathollah Varnik , Univ. ... Matthias Wessling , RWTH Univ. ...

Еще в разделе: (Показать все результаты (>20) - nanofluidics.phys.msu.ru/ )

• Alexander Potapov
• Alexander Vadimovich Kochergin
• Laboratory of Micro- and Nanofluidics

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>5) - seac47-2.phys.msu.ru/ )

... Faculty . ... News . ... 32-bit Microcontroller Programming . Microcontroller Control of Motors . Second-year students classes . ... Parallel Programming . ... Microcontroller Programming . ... Microcontroller-related . ... 2012/2013 . 2011/2012 . ... Serguey Elizarov . ... We sincerely wish you a Happy New Year and Merry Christmas! We hope that this year has been for you a year of new achievements. ... Happy New Year 2016! ... Senior Teacher of the Faculty of Physics at MSU,љ Cand. ...

Еще в разделе: (Показать все результаты (>69) - engineering.phys.msu.ru/ )

• Alexander Iovlev
• Alexander Monahov

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>5) - iconolat13.phys.msu.ru/ )

• Committees

Alexander M. Kuznetsov . ... Sasha Kuznetsov entered a famous Theoretical Department of the Institute of Electrochemistry AN USSR in 1961, and joined Prof. R.R.Dogonadze group, They pioneered the quantum mechanical theory of electron transfer in solutions, which now became a general theory of in chemical, electrochemical and biological systems. ... Concludingly A.M. Kuznetsov is one of the pioneers and creators of quantum mechanical theory of charge transfer processes in condensed media. ...

Еще в разделе: (Показать все результаты (>30) - electr003.chem.msu.ru/ )

• Theoretical Department of the Institute of Electrochemistry AN USSR
• Selected Articles
• Alexander Mikhailovitch Kuznetsov (Sasha)

... About lab . ... Courses . ... Online Journal "Computer graphics and multimedia" (in russian) . Educational courses (in russian) . ... E-mail: avelizhev@graphics.cs.msu.ru . I work in Graphics and Media Lab and have participated in many projects of the lab concerning image processing, camera calibration, 3d reconstruction and laser scanning data processing . My research interests include computer vision, photogrammetry, image and laser scanning data processing. ... e-mail: . ...

Еще в разделе: (Показать все результаты (>70) - graphics.cs.msu.ru/ )

• Alexander Voronov | Graphics and Media Lab
• Alexander Chigorin | Graphics and Media Lab
• Alexander Parshin | Graphics and Media Lab

. Rus / Eng . 0 . 2013 . Impact Factor . Log In or Register . Main . Staff . Publications . Journals . Conferences . Contacts . Main . Staff . Publications . Journals . Conferences . Contacts . Publications . Articles . Back to the list . Inststitutskii per. 9, Dolgoprudnyi 141700, Russia . a-p-ivanov@inbox.ru . Main . Staff . Publications . Journals . Conferences . Contacts . Institute of Computer Science Izhevsk, 2005 - 2016 .

Еще в разделе: (Показать все результаты (>26) - ics.org.ru/ )

• Institute of Computer Sciences - Staff - Korotkov Alexander G.
• Institute of Computer Sciences - Staff - Shaura Alexander S
• Institute of Computer Sciences - Staff - Kilin Alexander Alexandrovich

. Events About Structure . President Vice-Presidents The Presidium The Board The Council . Rector of Pyatigorsk State Linguistic University, the Chairman of the Council of Rectors of the North Caucasian Federal District . Back to the list . office@rsr-online.ru . 8 (495) 939-20-32

Еще в разделе: (Показать все результаты (>12) - www.rsr-online.ru/ )

• SHESTAKOV ALEXANDER LEONIDOVICH
• GULYAKOV ALEXANDER DMITRIEVICH
• LUNYOV ALEXANDER PAVLOVICH

PhD Summer School on Scentific Computing . ... Summer School Structure . The aim of the summer school is to support the research work of Doctoral students in the area of scientific computing, with particular reference to combinatorics. ... M che l h igeartaigh , Waterford Institute of Technology (Co-Chairperson) . Nina Popova , Moscow State University (Co-Chairperson) . ... Nina Popova , Moscow State University, popova@cs.msu.su . ... Irina Fedulova , Moscow State University, Russia . ...

Еще в разделе: (Показать все результаты (>4) - angel.cs.msu.su/ )

... Main Discography . Studio Albums . ... CD Singles . ... Joe Satriani . ... The Essential Deep Purple Survival Kit . ... Deep Purple Tribute Albums . ... The Highway Star's Deep Purple Discography seeks to cover all, or at least most, official releases. ... Joe Cath <joecath(at)aol.com> . ... Rasmus Heide <rasmus(at)deep-purple.com> . ... Benny Holmstr?m <benny(at)deep-purple.com> . ... Ed Janx <edjanx(at)deep-purple.com> . ... Stathis Panagiotopoulos <span(at)deep-purple.com> . ... Deep Purple ! ...

Еще в разделе: (Показать все результаты (>6) - shamolin2.imec.msu.ru/ )

. Error: Permission denied . ejudge 3.5.1+ (GIT 2eb5ef0) (2016-03-20 11:30:56) . Copyright 2000-2016 Alexander Chernov.

Еще в разделе: (Показать все результаты (>2) - ejudge.cs.msu.ru/ )

• []: Ошибка: Сервис недоступен