... Also during this work Dian drank a lot of tea with sugar, completed his description of urban and rural life (to the tunes of world-known musical "Notre-Dame de Paris"), wrote several poems about his dear friend GVR. ... Besides this project, Sergei A. Spirin with his colleague Andrew V. Alexeevski takes a very great part in different researches. Near their work room on the 3rd floor of the "A" laboratory building, near with the biological one, different colourful posters can be watched. ...

Еще в разделе: (Показать все результаты (>43) - monkey.belozersky.msu.ru/ )

• About this project
• Inquiry information || Schemes of phylogenetic trees
• About COGs

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . You may download the latest source code distribution and install the period search service at your own web server. ...

Еще в разделе: (Показать все результаты (>2) - scan.sai.msu.ru/ )

Research topics . ... This group is formed to study the reactions at semiconductor surfaces. ... Group members: . ... M.V. Lomonosov Moscow State University: . ... Dr. Tatiana S. Zyubina, senior scientific researcher (quantum chemical modeling) . ... Joint Semiconductors Surface Study group: research sketches . The Joint Semiconductors Surface Study (JSSS) group was developed on the base of Inorganic Chemistry division, Chemistry dept. of M.V. Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>101) - www.inorg.chem.msu.ru/ )

... History . ... Biochemistry Department founder . professor S.E. Severin . The Department of animal biochemistry was founded in 1939 by Professor (later Academician) Sergei Severin. ... At that time the new department had four small rooms in the old building of the Moscow State University on Mokhovaya Street. ... A new building of the Moscow State University on Lenin Hills was erected in 1954 and the Department of Biochemistry moved to the new building and was increased in size. ...

Еще в разделе: (Показать все результаты (>117) - biochem.bio.msu.ru/ )

• [The use of immobilized ubiquitin for biosensor analysis of the mitochondrial
• Chaperone-like activity of monomeric human 14-3-3zeta on different protein
• Probable participation of 14-3-3 in tau protein oligomerization and...

Red Square at Night . The guide books were wrong when they told me that Moscow is dreary in November. ... The sound stands in contrast with the enormous bustle of Moscow. I teach in the Humanities building, a large rectangular steel and glass mirror just out of the shadow of the skyscraper that symbolizes Moscow State University. Getting in and out of the Humanities building means edging into a fast-moving stream of students and faculty who are hustling to class. ...

Еще в разделе: (Показать все результаты (>20) - suny.msu.ru/ )

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>8) - tunka.sinp.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>203) - nuclphys.sinp.msu.ru/ )

Еще в разделе: (Показать все результаты (>49) - num-anal.srcc.msu.ru/ )

... Official address of the Faculty of Materials Science: . Leninskie gory 1, building 73, Lomonosov Moscow State University, Faculty of Materials Science, 119991 Moscow, Russia . Education Office . ... office 214, lab building B (bld. ... Tel: +7 (495) 939-45-51 . Fax: +7 (495) 939-09-98 . office . 237, lab building B ( bld . ... office 546, chemistry building (bld. ...

Еще в разделе: (Показать все результаты (>4) - www.fnm.msu.ru/ )

... General Information . ... For physics faculty . ... For natural faculties . ... Lomonosov Moscow State University is situated on the south-west of Moscow. The Department is placed at Physics Faculty, wich building is near the main building of MSU. ... Department of General Physics and magneto-ordered matter, . Faculty of Physics, . M.V.Lomonosov Moscow State University, . Leninskie gory, Moscow 119992, Russia . ... E-mail: . ...

Еще в разделе: (Показать все результаты (>24) - ferro.phys.msu.ru/ )

Geochemistry of chromite from middle-deep VYZHIGA MASSIF (SOUTH-EATS FENNOSCANDIA) . ... Chrome-spinel composition from the drill 59 (depth m.) in Vyzhiga intrusion, main Chromite horizone of Burakovsky deposit and some grains from Vetreny Poyas komatiitic basalt . ... Its concentration reaches 60% of the rock volume. ... Chrome-spinel composition from the “main chromite horizone” of Burakovso-Aganozersky massif is the similar to this from 59 drill in Vyzhiga (depth of 122.6 m). ...

Еще в разделе: (Показать все результаты (>756) - geo.web.ru/ )

• Eldfell, Heimaey, Iceland
• Все о геологии :: Кирилл Крылов

e-mail: nataliarukina@yandex.ru) - , , eEurope, eGov, , information and communications technology, ICT, e-government, eEurope, eGov, Internet, public administration . The article is devoted to the chronology of information and communication technologies development and current problems. Theorists and researchers of information society are mentioned. ... The article touches upon the problems of using information and communications technology (ICT). ...

Еще в разделе: (Показать все результаты (>102) - vestnik.socio.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>205) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Picornaviruses: discovering big in small
• GEA :: Gene Expression Analysis

... Rio de Janeiro) "Signal Processing: Data Analysis, Trigger and Implementation", tutorials . 22 June (Saturday), Lecture Hall 02, Main Building MSU . ... Digital Filtering . ... Signal Processing: Data Analysis, Trigger and Implementation . ... Stochastic Processing: Adaptive and Optimal Filtering . Data Compaction: Principal Components, discriminating analysis, topological mapping, independent components. Implementation: Digital Signal Processors (DSPs) and multiprocessing. ...

Еще в разделе: (Показать все результаты (>75) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/tut5.html
• http://acat02.sinp.msu.ru/presentations/seixas/posterandre.pdf
• http://acat02.sinp.msu.ru/presentations/perret-gallix/ACAT2002.doc

... We will dwell on linguistic aspects and Lexical Resources of POLITEXT branch having in mind some intermediate semantic representation of a whole text as the basis for differentiated Information Extraction. It is personal data (in the social sphere) recognition in texts that we focus on, see (Leontyeva et al. ... As the main instrument of semantic analysis of coherent texts this dictionary bears the important information on how to build BTF-units starting from lexemes of SemDict entries. ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Resources for Textual Content Compression
• Semantic Dictionary for Text Understanding and Summarization

. UNIX provides you with a comprehensive programming environment. There are tools for: . automating program builds . checking program syntax . de-bugging source code . maintaining different versions of source files . producing program documentation . Using the Source Code Control System .

Еще в разделе: (Показать все результаты (>152) - comet.sai.msu.ru/ )

• UNIX file system
• **Important**
• Description of different types of shell

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... In 1940, it was named after Academician Mikhail Lomonosov (1711-1765), an outstanding Russian scientist, who greatly contributed to the establishment of the university in Moscow. ... About the Faculty of Journalism, Lomonosov Moscow State University . The history of the Faculty of Journalism, Lomonosov Moscow State University is very rich. ...

Еще в разделе: (Показать все результаты (>170) - www.journ.msu.ru/ )

• Virtual Tour :: Department of Journalism, M. V. Lomonosov Moscow State
• Conferences :: Department of Journalism, M. V. Lomonosov Moscow State

To view the high resolutiuon photos press the images. ... The size of each photo is from 1.5 to 3.5 MBytes. ...

Еще в разделе: (Показать все результаты (>41) - rswater.phys.msu.ru/ )

• Laboratory of laser spectroscopy of solutions of supramolecular compounds and
• Group of laser spectroscopy of solutions of supramolecular compounds and

... if (B1) { S1; } if (B1) { S1; } if (B2) { S2; } - - ...exp... int x = 1; if (x == 1) { std::cout << "Okay" << std::endl; } else { std::cout << "Error" << std::endl; } -- ­ int strlen(const char* p) { int len = 0; do { ++len; } while (*p++); return len; } «», «bbb» -- , : · ­ , , · ­ , , · ­ , · ­ . ... 1977 ­ LTL, · , 1981 ­ (CTL), · , , 1981 , , 1982 ­ model checking ( ), · , 1986 ­ model checking ( ), · , 1989 ­ SPIN. ... The Spin Model Checker: Primer and Reference Manual, Addison Wesley, 2003. ...

100. List All Categories