... Географии мирового хозяйства . ... Образование . ... National Animals of South America - The VicunaPeru's National AnimalThe vicuna is the national animal of Peru its national bird is theAndean cock-of-the-rockand is also seen on the Peruvian coat of arms. hollister This is because they will have a need to not only ensure that their children are protected in the event of death but also benefit from a policy that carries a cash value that they can leverage to plan for their children's financial...

Еще в разделе: (Показать все результаты (>214) - www.geogr.msu.ru/ )

• foot much roland suited representing an oliver up integument critique...
• cerbrovgds cerbrovgds (все сообщения)
• kdswilq|ellabha kdsotde|ellanqnJH (все сообщения)

... Запятая между наречным придаточным предложением и главным предложением . Как правило, между наречным придаточным предложением и главным предложением ставится запятая, если наречное предложение предшествует главному: . If you think you can learn to write well without hard work, you are mistaken . ... Если наречное предложение короткое, то запятая может быть опущена. ... Чтобы избежать недоразумений, лучше всегда ставить запятую после наречного придаточного предложения, предшествующего главному. ...

Еще в разделе: (Показать все результаты (>25) - num-anal.srcc.msu.ru/ )

download:rn-070605 ]] . CompHEP . ... THE VERSION 4.4.90 IS A TEST RELEASE! ... A new format of the initial state in session.dat. ... So, these tables will be empty if a user tries to use old files in the new version. ... Several bugs in generation of session.dat with s_comphep . ... All PDFs in the beam/strfun tables have prefix PDF (or LHA, if LHAPDF is interfaced) . ... A new version of make_tab. ... Check LHAPDF-compatible session.dat in internal- PDF -compatible n_comphep (and vice versa) . ...

Еще в разделе: (Показать все результаты (>17) - comphep.sinp.msu.ru/ )

• download:rn-080423 [CompHEP]
• news [CompHEP]
• download:rn-070606 [CompHEP]

... Conference Schedule . ... Visa Support NEW! ... Registration . For registration at the 14th International Meeting of the International Humic Substances Society (IHSS) please download the Registration Form , fill it in, and send to the Conference Secretariat by e-mail ihss@org.chem.msu.ru . ... Registration Fee and/or Accommodation and/or Social Fee for Participation at the IHSS-14 Conference from " Full NAME of Participant(s) " . ... September 13, 2008, 9 a.m. - 9 p.m. - Arrival Day . ...

Еще в разделе: (Показать все результаты (>107) - mgumus.chem.msu.ru/ )

... The effects of cultivation temperature, illumination, and presence of mineral nitrogen and bicarbonate in the medium upon adaptation of enrichment cultures to substrates and subsequent behavior of the anaerobic associations have been studied. ... Anaerobic enrichment cultures degrading ABA and ASA isomers were obtained directly from active methanogenic sludges that had been adapted for degradation of corresponding aminoaromatic acids more than two years previously [15]. ... 4 2005 Vol. ... Vol. ...

Еще в разделе: (Показать все результаты (>93) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/bc2007/Social_program.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/Sergey-2005.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/abb_2003_253263.pdf

The paper of Eugene Babaev "Intuitive Chemical Topology Concepts" . ... These objects with quite different geometrical properties have homeomorphic 2 D surfaces, which can be continuously deformed one to another or to the same surface of a torus. ... This approach (a generalization of our earlier works [29-33]) allows us to apply the homeomorphism concept to chemical problems in a new way, classifying molecular structures and reactions from the viewpoint of the topology of surfaces. ... Surfaces . ...

Еще в разделе: (Показать все результаты (>93) - www.chem.msu.ru/ )

• THE ALTERNATION RULE: AN OLD HEURISTIC PRINCIPLE OR A NEW CONSERVATION LAW
• Concept of Chemical Periodicity: from Mendeleev Table

... Optical Tamm state at the cholesteric liquid crystal/metal interface Gulkin D.N., Bessonov V.O., Sob oleva I.V., Fedyanin A.A. Faculty of Physics, Lomonosov Moscow State University, Moscow, 119991, Russia e-mail: bessonov@nanolab.phys.msu.ru Optical Tamm state (OTS) is an optical analogue of Tamm state which is electronic density lo calization at the b oundary of p erio dic atomic p otential. ... Fig. 1c demonstrates that the OTS excitation o ccurs over a large range of angles of incidence. ...

Еще в разделе: (Показать все результаты (>45) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/pe14_abstracts.pdf
• http://nanolab.phys.msu.ru/sites/default/files/ol33_2749_2008.pdf
• http://nanolab.phys.msu.ru/sites/default/files/pre80_046602_2009.pdf

... 4) Percolation probability: [pic] , where L is linear size of lattice. ... The presence of obstacles in a system leads to: - increase of the critical concentration value; this effect grows with increase of the full area of obstacles and falls with increase of the linear size of ones. - increase of the critical exponent ( value; this effect increase with growth both of linear size of obstacles and of their full area. - increase of the growth rate of ...

Еще в разделе: (Показать все результаты (>40) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/tobimatsu/tobimatsuk.pdf
• http://acat02.sinp.msu.ru/presentations/shibzoukhov/acat2002_spnn.pdf
• http://acat02.sinp.msu.ru/presentations/ososkov/ACATOsoskov.doc

. Lomonosov Moscow State University Faculty of History . Electronic Recourses Library . Русская версия . Electronic texts (in Russian) . Databases (in Russian) . Digital sources and Palaeography . Links for reference books (in Russian) . Art and History Museums around the World (in English) . Revised - September, 26th, 2009 . Lomonosov Moscow State University . Association "Istoria and Comp'uter" - the Russain branch of the AHC

Еще в разделе: (Показать все результаты (>127) - hist.msu.ru/ )

• Moscow State University. Faculty of History
• The Evolution of the Russian Tax System in the 19thcentury
• A. Gow. Gog and Magog

... High Power Ultrasound in Making and Breaking Polymers . G.Price (University of Bath, Bath, UK) . ... The usefulness of ultrasound in preparative work will be illustrated by reference to investigation of radical polymerisation using sonoluminescence and spectroscopic measurements, with other applications selected from the preparation of silicon containing polymers by reactions at metal surfaces, emulsion polymerisation processes and the modification of polymer surfaces. ...

Еще в разделе: (Показать все результаты (>80) - acs366.phys.msu.su/ )

• Abstract

... HAPPY NEW YEAR!! Happy new year to all!! ... Staff and all the teachers of the MGU Russian language centre offer congratulation the students and all the people around the world on Christmas, wishes all the best!! ... 29.12.2003 . Merry Christmas!! ... On the 25 th of December the first international seminar "Studying the Persian language in Russia and CIS: the possibilities and needs" in the Institute of the African and Asian countries attached to the MGU. (more.. ... Baghdad is still alive. ...

Еще в разделе: (Показать все результаты (>5) - www.rlcentre.com/ )

General Information . ... Program . ... Symposium expenses . ... Presentation information . ... Cultural Program . Travel information . Contact information . 14 European Symposium on . Gas Phase Electron Diffraction . 24-28 June 2011 . ... On 26 June 2011 there will be a bus excursion around Moscow city including a walking excursion inside the Kremlin. ...

Еще в разделе: (Показать все результаты (>3) - ged.chem.msu.ru/ )

... Basic Screening by Similarity . ... Full Query Form . ... Protein databanks: . SWISSPROT protein databank TREMBL protein databank . ... DNA/RNA Blosum 30 Blosum 50 Blosum 62 Dayhoff Johnson . Query sequence name . ... Query Sequence (without name) OR Alignment . ... FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSR FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSR KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIF FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>124) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Лаборатория регуляции белкового синтеза
• Screening protein sequence against PROSITE databank

... Next: Window scrolling Up: Dealing with Windows Previous: Dealing with Windows Contents Index . Ordering Windows can be done by two Commands Cascade and Tile from the Menu Window. The Command Cascade will put the Windows one after another in diagonal direction starting from the upper left corner of the Window. The Command Tile put the Windows without intersection one by one from left to right and from up to down. ...

Еще в разделе: (Показать все результаты (>50) - www.spm.genebee.msu.ru/ )

• Changing Image Resolution
• APPLICATION OF SCANNING PROBE MICROSCOPY TO THE STUDY OF DNA CONFORMATION
• Addition and Subtraction of Images

Previous Next Galleries . Steam locomotive, but surprisingly without Andrei Olenev :-) Previous Next Galleries

Еще в разделе: (Показать все результаты (>39) - www.inorg.chem.msu.ru/ )

News . News Archive . ... SUNY @ Albany Delegation from the Department of Mathematics and Statistics headed by the Dean E. Turner including prof. B. Goldfarb and prof. K. Zhu. ... Do not leave without exploring our News Archive . ... suny-msu . ...

Еще в разделе: (Показать все результаты (>16) - suny.msu.ru/ )

• Центр по делам России и США :: Публикации

... 5) Two variant of calculation: Main 1 (absence of SNRs in the Earth vicinity with Emax =4 PeV ) and Main 2 (where 4 SNRs accelerate to 4 PeV ) give more or less similar structures around the knee Here we need to know MetaGalactic Sum Gal+Metag 025 0.20 · 10 7 · F(E) E 10 6 P He 3 .0 Fe · 10 5 C,O Si Pure Galactic · 10 4 10 4 10 5 10 6 10 7 10 8 10 9 10 10 10 11 10 12 E, GeV Contribution of nearby actual sources 10 1 Main 2 all p he cno si fe nearby ...

Еще в разделе: (Показать все результаты (>6) - tunka.sinp.msu.ru/ )

... Parallel jobs run on SMP/multi-core hardware without additional software. ... New drag and drop job submission applications make running jobs significantly easier and more intuitive than most other ab-initio computational chemistry programs on the Mac platform. Just drag and drop your input file on to the appropriate run application for the number of CPU cores desired (or double-click and select) and your job will simply launch and open the output in a suitable text editor. ... Firefly forum . ...

Еще в разделе: (Показать все результаты (>46) - classic.chem.msu.su/ )

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

100. Photo report: Participation in XIIth International Conference on Laser