... Main results of different objects studying using scanning probe microscopy methods are 3-dimensional images of these objects usually. ... It gives significantly more convenient image processing, but photographic quality, common for electronic microscopy methods was lost. Information obtained with scanning probe microscope is represented in a computer as numbers in 2 dimensional matrix. ... Thus, every matrix value is represented by point of some colour on a rectangular image. ... Averaging data . ...

Еще в разделе: (Показать все результаты (>157) - www.spm.genebee.msu.ru/ )

• Fast probe landing and retraction
• Data Processing Functions (Mathematics Menu)
• Files Saving and Export

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... 2000 December 15 . IC443's Neutron Star . ... Explanation: Using x-ray data from the orbiting Chandra Observatory along with radio data from the Very Large Array , a team of researchers has discovered evidence for a new example of one of the most bizarre objects known to modern astrophysics -- a neutron star . ... The core collapsed when the star, located a reassuring 5,000 light-years away in the constellation Gemini , exploded long ago. How long ago? ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 January 3 - Cas A Supernova Remnant in X Rays

DVM-system of parallel program development . Installation guide . ... 1 DVM-system installation under Windows95/NT . ... Microsoft Visual C++ 5.0 version and later (4.0 version can be used with some restrictions, see below); . ... Now the user should copy all files from directory dvm_sys/user to his own directory with DVM programs. ... In this case (but if DVM-system installation was succesfully verified) the user should keep above files with errors and ask for system programmer support. ...

Еще в разделе: (Показать все результаты (>133) - sp.cs.msu.ru/ )

• DVM-system. Installation guide. Version 3.30
• DVM-system. Installation guide. Version 3.82
• DVM-system. Installation guide. Version 3.15

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>8) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/numtask/unnu12.pdf
• http://tex.bog.msu.ru/rustexeo.html
• http://tex.bog.msu.ru/numtask/unixhlp.ps

. General information . Dear Univerat-2009 visitor! To participate in the conference, please, register (once) at the conference site and submit Your information! . Please, use your e-mail adress as a login name. If You have any problems (e-mail is already registered or password is forgotten), please contact Organizing Committee: universat2008@gmail.com ! . Participant's registration . Login (E-mail): . Password: . Password again: . Entrance to information submition form: . Login (E-mail) . Password .

Еще в разделе: (Показать все результаты (>60) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

... There is a distinction between buried soil and paleosol, even though the two overlap considerably. ... On the other hand, pre-Holocene paleosols in my area (southeastern Minnesota) don't look like buried soils, and are never recognized as such except by specialists. ... By this criterion, the pre-settlement alluvial soils of southeastern Minnesota are borderline paleosols, where they have been buried by sediments eroded from plowed fields. ...

Еще в разделе: (Показать все результаты (>128) - www.fadr.msu.ru/ )

• REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August...
• Abstracts
• Herbicide sensitivity of different species

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>21) - foroff.phys.msu.ru/ )

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>23) - cdfe.sinp.msu.ru/ )

• EXFOR Search Engine
• CDFE => Online Services => Nucleus Ground State Parameters

Back to homepage >> . ... key words: [ melt inclusions, experiment, diffusion, boundary layer effect ] . ... In order to distinguish an influence of the boundary effects on the composition of melt inclusions, the experiment on growth of alkali feldspar (Fsp) crystal in the haplogranitic system (Q-Ab-Or) was performed. ... Estimation of an influence of the boundary effect on melt inclusion composition . ... The larger inclusion the weaker its influence on the boundary layer. ...

Еще в разделе: (Показать все результаты (>329) - geo.web.ru/ )

• The influence of boundary layer effects on the melt inclusions compositions.

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . Algorithm performs detection and tracking of foreground objects. Each frame of video sequence is subdivided into regions of two types: foreground and background objects. ... The main obstacle for segmentation here is the abundance of highly textured objects and sophisticated character of motion (bus is moving behind the static fence). ... video@graphics.cs.msu.ru . ...

Еще в разделе: (Показать все результаты (>211) - graphics.cs.msu.ru/ )

• Hide information in video | Graphics and Media Lab
• Automatic Binary Segmentation of Moving Objects in Video | Лаборатория
• Hide information in video | Лаборатория компьютерной графики и мультимедиа

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>72) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• Anis. Page2

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>18) - tukachev.flogiston.ru/ )

• Category: Новости

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

95. User account | CMC MSU

96. http://www.socio.msu.ru/vestnik/archive/2012/3/13.pdf

97. http://sbmg.geol.msu.ru/polinf/comunits/help.htm

98. tunka_graph

99. A Different Kind of Christmas - Фильмы - Kinfo.ru

100. http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf