. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>416) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• S : 3D_of_rm_system_components

... SB, Porb = 55.9212d. V0745 Cas| ... Component B of the double system observed brighter than in the Hipparcos Input Catalogue. ... The variability may be due to the fainter component. ... Type ELL: is also possible. pi Cas| ... Variability type and spectral type (F2/F3Ib/II) do not agree. ... Variability type and spectral type (F3/F5II) do not agree. ... Variability may be due to component B. VZ Pic| ... Variability may be due to component B. V1377 Ori| ... SB, Porb = 9.073d. V0421 Cep|105091| ...

Еще в разделе: (Показать все результаты (>19) - www.sai.msu.ru/ )

... 2) to undertake multuaspectual reseach of textual and dictionary data using developing software, including combination and comparison of various classifications of textual and dictionary elements of Natural Language. Up to now in majority of cases systems for text processing, on the one hand, and systems for accumulation and analysis of dictionary data, on the other, are elaborated separately. ... It provides a user with ability to control and analyse some textual data. ...

Еще в разделе: (Показать все результаты (>46) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics
• MSU-LGCLL:: Anatoliy A.Polikarpov - Semasiological and Word-formational

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>139) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

Diploma thesis abstract Spectroscopy of the hot electron component in the relativistic femtosecond laser plasma Borisov Nikita Ivanov Konstantin At research of the fundamental processes of particle acceleration in relativistic laser plasma considerable attention is given to accurate registration effects, which contributes to their understanding and explanation. ... Workings out of methods of registration and selection signals were conducted. ...

Еще в разделе: (Показать все результаты (>84) - ofvp.phys.msu.ru/ )

• Laboratory of solid-state lasers and coherent spectroscopy

... Faculty of Physics . ... 7 (495) 939-16-82 info@physics.msu.ru . ... Second harmonic generation in metamaterials with magnetodipole resonance . ... Konstantin Zhukovsky (Faculty of Physics, Department of Theoretical Physics, MSU) gave complete analytical description of the harmonic generation in undulators with accurate account for all major losses in real devices and demonstrated how the electron beam emittance can be compensated by properly imposed constant magnetic field. ... 7 495 939-16-82, . ...

Еще в разделе: (Показать все результаты (>60) - phys.msu.ru/ )

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>129) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Department of Computational Technologies and Modeling | CMC MSU
• Research Laboratory of Computational Modeling Tools | CMC MSU

... 26, No. 9, 791­799 doi:10.1006/cbir.2002.0946, available online at http://www.idealibrary.com on CENTROSOME -DEPENDENT ANISOTROPIC RANDOM WALK OF CYTOPLASMIC VESICLES IVAN V. MALY* and IVAN A. VOROBJEV Laboratory of Cell Motility, A. N. Belozersky Institute of Physico-Chemical Biology, Moscow State University, Moscow 119899, Russia Received 27 September 2001; accepted 28 June 2002 We approach the problem of an apparently random movement of small cytoplasmic ... 1997; Bray, 2001). ... 1997). ...

Еще в разделе: (Показать все результаты (>31) - cellmotility.genebee.msu.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>4) - physcontrol.phys.msu.ru/ )

... О МЛЦ МГУ . ... Главная Cотрудничество ILC of Bratislava ILCB laboratories Laboratory of Optical Diagnostics and Visualization CCD detectors . ... Recording of images in digital format facilitates their processing, archiving, and transmission. Gated image intensifiers make it possible to study the processes of the nanosecond time scale. Thus, the CCD-based detection systems supplement FOG-100 in the sense of the time resolution and substantially extend the time scale of the measurements. ...

Еще в разделе: (Показать все результаты (>41) - ilc.phys.msu.ru/ )

• Diagnostic appliances and setups for femtosecond spectroscopy
• Multichannel spectroscopy
• Multipurpose all-solid femtosecond laser complex

... Custom Query . ... Component . ... automata io requirements ui . ... В And В Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . Or В Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . ... Summary Component Milestone Status Owner Type Priority Resolution Created Modified Blocked By Blocking Reporter Keywords Cc . ...

Еще в разделе: (Показать все результаты (>414) - kodomo.cmm.msu.su/ )

• Custom Query ? Cyclyc Cell Automata

Title Author Key words Nevskaya T.A. Hybrid wars' information component hybrid war, aspects of hybrid warfare, information warfare The war of the new generation ­ hybrid war, the information component which is directed not so much on the direct destruction of the enemy, how to achieve the goals without warfare. Fighting in the information field is no less important than immediate military action. Abstract

Еще в разделе: (Показать все результаты (>32) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/4/14.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2014/3/05.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2014/3/06.pdf

... L Сd , Pol a nd ABOUT EFFECTIVE MODES METHOD FOR DESCRIPTION OF INTERNAL DYNAMICS OF WEAKLY BOUND CLUSTERS Elena Belega, Evgeny Cheremukhin 1 , Dmitry Trubnikov Abstract: New approach to describe the internal dynamics of weakly bound clusters is presented. ... It is found that the number of active collective modes depends on the initial cluster excitation and that the internal energy is partitioned nonuniformly among the modes. ... Collective motion of oxygen atoms performs mostly in plane. ...

Еще в разделе: (Показать все результаты (>18) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/doc/JCPSA613314144101_1.pdf
• http://beams.chem.msu.ru/doc/JAP2004_96_109.pdf
• http://beams.chem.msu.ru/sotrudniki/larin/IJQC83.pdf

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>95) - hist.msu.ru/ )

• Department of Foreign Languages
• Visual Images of Patriarch Nikon
• Russian Culture Lab

БАКАЛАВРИАТ . ... MBA . EXECUTIVE MBA . ... Завершается напряженный учебный год! ... забег на дистанцию 4 км; . ... Дата: 28 мая 2011 год . ... Executive MBA . ... Бакалавриат . ... январь февраль март апрель май июнь июль август сентябрь октябрь ноябрь декабрь 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 . ... Аккредитация программы Бакалавр . Аккредитация финансовых курсов программ Бакалавр и Магистр . ...

Еще в разделе: (Показать все результаты (>492) - www.mgubs.ru/ )

• Весенний забег Высшей школы бизнеса МГУ aCROSS the UNIVERSity 2015.
• Осенний кросс Высшей школы бизнеса МГУ aCROSS the UNIVERsity
• Весенний кросс Высшей школы бизнеса МГУ aCROSS the UNIVERSity состоится 10

... The oxidation of PbTe(100) surface in dry oxygen. Surface and Interface Analysis, 2004 (in press) . ... The oxidation of PbTe (100) surface in dry oxygen was studied by means of XPS. The appearance of a Te 4+ component in Te3d spectra and an additional component shifted to 1 eV in Pb 4f spectra was observed. ... Quantum chemical modelling of the interaction of small cluster (PbTe) 4 with one oxygen molecule was performed in the frames of density functional theory (B3LYP). ...

Еще в разделе: (Показать все результаты (>39) - www.inorg.chem.msu.ru/ )

• Inorganic Chemistry Division

... The Early Pale oproterozoic gabbronorite dikes contain a secondary component of NRM that is pointed NNW with a strong positive slope that is correlated with the post orogenic collapse of 1.95­1.88 Ga B.P. Formation of the second alternating magnetization phase of rocks is estimated at 1.8­1.75 Ga B.P., which corresponds to the influence of post orogenic hydrothermal fluids. ... Negative folding and contact tests indicate the secondary nature of this high temperature magnetiza tion component. ...

Еще в разделе: (Показать все результаты (>18) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Koronovsky_etal_2015_eng.pdf

... A11, 1393, doi:10.1029/2001JA005073, 2002 Statistical distributions of field-aligned electron events in the near-equatorial magnetosphere observed by the Low Energy Plasma Analyzer on CRRES G. A. Abel,1 A. N. Fazakerley, and A. D. Johnstone2 Mullard Space Science Laboratory, University College London, Holmbury St. Mary, Dorking, Surrey, UK Received 27 August 2001; revised 26 April 2002; accepted 22 August 2002; published 22 November 2002. ... FIELD-ALIGNED ELECTRON EVENTS SMP 29 - 3 Figure 1. ...

Еще в разделе: (Показать все результаты (>72) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/pdf1/abel_02b.pdf
• http://www.kosmofizika.ru/pdf1/russell_jastp99.pdf
• http://www.kosmofizika.ru/pdf2/angeokoz-2006.pdf

... Data . ... Models . ... The International Geomagnetic Reference Field (IGRF) model is an empirical representation of the Earth's magnetic field recommended for scientific use by a special Working Group of the International Association of Geomagnetism and Aeronomy (IAGA). The IGRF model represents the core field without external sources. ... The NSSDC version uses the subroutines FELDG (magnetic field vector) and SHELLG (L shell) developed by G. Kluge at the European Space Operations Center (ESOC). ...

Еще в разделе: (Показать все результаты (>28) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• COHO project - Space monitoring data center