... METHOD . ... public interface AttributeSet . AttributeSet is an inquiry interface for a collection of Attributes. ... Tests if the Attribute identified by name is in this set. ... Retrieve the attribute associated with the specified name. ... Returns AttributeIterator for the elements. ... a new Array containing the elements of this set. public Attribute get (java.lang.String name) . ... If a different Attribute with the same name, was in the set, it is returned, otherwise null is returned. ...

Еще в разделе: (Показать все результаты (>75) - angel.cs.msu.su/ )

• : Class Schema
• Summary
• : Package ucar.multiarray

... Printed in U.S.A. COMPLEX FORMATION HISTORY OF THE LENTICULAR GALAXIES WITH STELLAR COUNTERROTATION: NGC 4138 AND NGC 45501 V. L. Afanasiev Special Astrophysical Observatory, Nizhnij Arkhyz, 369167 Russia; vafan@sao.ru and O. K. Sil`chenko 2 Sternberg ... To further explore this idea, we undertook a special study of stellar population properties in the centers of two early-type disk galaxies with counterrotating global stellar disks: NGC 4138 and NGC 4550. ... NGC 4138 3.1. ... NGC 4550 4.1....

Еще в разделе: (Показать все результаты (>50) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/n80eng.pdf
• http://sn.sai.msu.ru/~sil/preprints/ar281.pdf
• http://sn.sai.msu.ru/~sil/preprints/203546.ps.gz

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>167) - www.genebee.msu.ru/ )

• BLAST 2.0 Release Notes

... Главная -> Фильмы -> August . ... Фильмы . ... August . ... США - Великобритания 1996 . ... Anthony Hopkins . ... Kate Burton . ... Rhian Morgan . ... Buddug Morgan . ... J?ms Thomas . ... Morgan Ritchie . ... Dylan Thomas . ...

Еще в разделе: (Показать все результаты (>707) - kinfo.ru/ )

• August Rush - Фильмы - Kinfo.ru
• December Boys - Фильмы - Kinfo.ru
• december - Пользователи - Kinfo.ru

... 247th American Chemical Society National Meeting and Exposition "Chemistry and materials for energy" , March 16-20, Dallas, TX Talk: A.V. Nemukhin "QM/MM-based modeling of structure and spectra of fluorescent proteins" . ... IV International Symposium "Topical Problems of Biophotonics", July 21-27, Nizhny Novgorod Invited talk: M.G. Khrenova , A.V. Nemukhin, A.P. Savitsky "Molecular modeling of the Forster resonance energy transfer between fluorescent proteins" . ...

Еще в разделе: (Показать все результаты (>9) - lcc.chem.msu.ru/ )

Deleting a Wiki Page = Existing wiki pages can be completely deleted using the ''Delete Page'' or the ''Delete this Version'' buttons at the bottom of the wiki page. ... If you want to delete a page because you actually re-created a new page with the same content but a different name, it is recommended to keep the page and use it as a redirection page instead of completely deleting it, as to not frustrate the visitor with broken links when coming to the site from a search engine. ...

Еще в разделе: (Показать все результаты (>1547) - kodomo.cmm.msu.ru/ )

• Esherichia coli
• TracChangeset тАУ Tanchiki
• WikiProcessors тАУ Tanchiki

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>132) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - Algorithm Format requirements

... education . ... Thu, 18/07/2013 - 01:09 ? ... С 19 по 22 августа 2013 года в Лондонском центре нанотехнологий состоится седьмая международная студенческая нанотехнологическая конференция . The London Centre for Nanotechnology, a joint venture between University College London and Imperial College London, will be hosting the 7 th INASCON (International Nanoscience Student Conference) from the 19 th ? 22 nd August 2013. ... Registration is open until 1 st August 2013. ...

Еще в разделе: (Показать все результаты (>17) - nano.msu.ru/ )

... Effect of mutations in the beta5-beta7 loop on the structure and properties of human small heat shock protein HSP22 (HspB8, H11). ... Because conservative Lys residues located in the beta5-beta7 loop and in the beta7 strand appear to play an important role in the structure and properties of HSP22, mutations in this part of the small heat shock protein molecule might have a deleterious effect and often correlate with the development of different congenital diseases. ...

Еще в разделе: (Показать все результаты (>88) - biochem.bio.msu.ru/ )

• Structure, properties, and functions of the human small heat-shock protein
• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• [Different domain organization of two main conformational states of

You are here: Foswiki > System Web > Skins > PatternSkin > PatternSkinCss (revision 1) E dit A ttach . This page is a reference for all CSS classes used in PatternSkin . ... colors.css : text colors, background colors, border colors . ... Positional containers are referred by id, for instance #patternSideBar . ... patternScreen - outer container, used when centering the page (see PatternSkinCssCookbookCenterPage ) . ... patternTopBarContents - header art / logo; contains topic WebTopBar . ...

Еще в разделе: (Показать все результаты (>5501) - wiki.cmc.msu.ru/ )

• JQueryThemeSwitcher < System < Foswiki
• TemplateWeb < System < Foswiki

... MI RAN, Alexeyev Conference, 23-28 December . MODERN THEORY OF DYNAMICAL SYSTEMS AND APPLICATIONS TO THEORETICAL CELESTIAL MECHANICS . ... Moscow, December 23-28 . ... SECTION A mostly includes talks in celestial and Hamiltoinian mechanics, symplectic geometry, and some other topics. ... MORNING SESSION 9:30-10:20 . ... BREAK . 12:00-12:50 . SECTION A . ... Special session: SCIENTIFIC LEGACY OF V.M.ALEXEYEV . ... On the works of V.M. Alexeyev in celestial mechanics and dynamical systems. ...

Еще в разделе: (Показать все результаты (>57) - www.mmonline.ru/ )

• MMOnline | Новости | MI RAN, Alexeyev Conference, 23-28 December

... Second set contains blast hits of the contig or the chromosome search against protein database, for example, Uniref90. ... Hit color corresponds to reading frame in the contig, color intensity is grteater than intensities of exons. ... Reading frame of five blast hits in the third exon of gene g4 are different than exon's reading frame . Blast hits in gene g3 located on reverse strand do not match reading frames of the 1st and 3rd exons and overlap 1-2 and 2-3 introns . ...

Еще в разделе: (Показать все результаты (>74) - mouse.belozersky.msu.ru/ )

• Geometrical core
• wLake program homepage
• PDB entries containing domains of the family "RNA dependent RNA polymerase"

... 28 December 2015 We congratulate Alexey Vervald, Ernest Mazurin and Ivan Plastinin with exelent marks for diploma work! ... We congratulate Alexey Vervald, Ernest Mazurin and Ivan Plastinin with their exelent marks for their course works! November 2014. ... October 26-31, 2014. ... We congratulate Alexey Vervald, Ernest Mazurin and Ivan Plastinin who returned from expedition to the WSBS. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>29) - rswater.phys.msu.ru/ )

• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и
• Group of laser spectroscopy of solutions of supramolecular compounds and

. Pictures from Italy! .

Еще в разделе: (Показать все результаты (>35) - cellmotility.genebee.msu.ru/ )

... Conferences . ... http://gct.math.nsc.ru/?event=metric-structures-and-control-systems . International Conference METRIC STRUCTURES AND CONTROL SYSTEMS will take place in Sobolev Institute of Mathematics, Novosibirsk, Russia, December, 17 ? ... The conference is organizing by the Laboratory of Geometric Control Theory of the Sobolev Institute of Mathematics (SB RAS) within the framework of the Project ?Geometric Control Theory and Analysis on Metric Structures?. ...

Еще в разделе: (Показать все результаты (>114) - ics.org.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>16) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.