... Head of Analytical Chemistry Division, Department of Chemistry, Lomonosov Moscow State University. Principal researcher, Kurnakov Institute of General and Inorganic Chemistry, RAS. ... 1950-1955 - student of Department of Chemistry, Lomonosov Moscow State University. ... Since 1978 - professor of Analytical Chemistry Division, Department of Chemistry, Lomonosov Moscow State University; since 1989 - head of the Division (half time). ... USSR State Prize (1972) . ... Moscow State University . ...

Еще в разделе: (Показать все результаты (>43) - analyt.chem.msu.ru/ )

• Лаборатория Электрохимических Методов

... Магистерское образование . ... Магистерские программы . ... Магистерские программы (учебные планы) . ... Introduction to Cryptography . ... Basic requirements for data security in software systems. ... Lecturer: associate professor Primenko E. A. Mathematical Theory of Information . ... Addition operation of elliptic curve's points. f Postnikov's theorem.Theorems on the order of elliptic curve for certain types of primes. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>9) - hcs.cmc.msu.ru/ )

• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |
• Master program "Enterprise Information Systems" | Магистерское и послевузовское

... You buy Gucci shades from the company store in the us. There are a total of 7 Gucci stores in different metropolitan areas like Honolulu, Hawaii, Boston. Or if you?re planning an overseas trip to Europe and then sure you visit part of the Gucci retail stores. One can find the brand stores in Florence, . ... These stores offer complete and original associated with designer Gucci Sunglasses and associated accents. ... One should be careful not purchaser gucci Fake. ... 2016 С Днем Победы! ...

Еще в разделе: (Показать все результаты (>123) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• Наши ветераны | С Днем Победы!
• cheap longcham | С Днем Победы!

International Laser Center of MSU . Home . ... Education . ... Booklet about ILC MSU . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . Moscow Vyatichi, November 9 - 11, 2009. ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home About ILC MSU Staff Chesnokov Sergey S. sergeychesnokov@mail.ru . ... 2009 ILC MSU Made in: Sebekon IT Solutions . ...

Еще в разделе: (Показать все результаты (>80) - ilc.phys.msu.ru/ )

• http://www.ilc.msu.ru/en/about/staff/chikishev_a_yu/
• http://www.ilc.msu.ru/en/about/staff/morozov_v_b/
• http://www.ilc.msu.ru/en/about/staff/shlenov_s_a/

Dynamical systems analysis of the gene regulatory network: on example of Drosophila early segmentation Alexander V. Spirov The Sechenov Institute of Evolutionary Physiology and Biochemistry, Russian Academy of Sciences , Saint-Petersburg, Russia; and Computer Science, State University of New York at Stony Brook, Stony Brook, NY, USA; alexander.spirov@gmail.com Fruit flies (Drosophila) are model organisms for studying spatial pattern formation in animals. ... 2009), PLoS Biol., 7(3): e1000049. ...

Еще в разделе: (Показать все результаты (>189) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/39.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/144.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/179.pdf

... The first idea ­ an arithmetic triangle. ... In work [1] has been offered descriptive geometric optic model on the basis of consideration of binomial distribution for the description of propagation of light in the laser. ... In work [3]the new algorithm of construction of a nonlinear arithmetic triangle on the basis of numerical modeling and binary notation has been offered, communication of the offered algorithm and binomial coefficients of various types is shown. ...

Еще в разделе: (Показать все результаты (>136) - www.mce.biophys.msu.ru/ )

• Books : Business Communication / Деловое общение
• Books : The physics of communication.Contributions to the XXII Solvay

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>116) - sp.cs.msu.ru/ )

• DVM-system. Goals and structure
• HPF DVM. Language specification
• C-DVM language description

... создается некое подобие 3-х мерного пространства Слова показа и и отображены таким же способом. -- param name =example_object_0 value = pltext step =20 font =Verdana:28,3 value =%АППЛЕТ% link = exline :0 color =#009999 param name =example_object_1 value = pltext step =20 shifts=2,2 font =Verdana:28,3 value =%АППЛЕТ% link = ...

Еще в разделе: (Показать все результаты (>15) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer4text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/cursor/cursor1text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer1text1.htm

... Mathematical Treatment of Exhaust Systems with Acoustic Properties Using Mathlie I. Algorithms . ... The first part of the two talks is concerned with   algorithms applied to examples origin from an   exhaust system. ... The model equations are determined   by conservation of mass, momentum and energy. In addition there exists an equation of state   for the ideal gas system. ... Applying computer algebra to   these model equations, we demonstrate that   solutions can be derived. ...

Еще в разделе: (Показать все результаты (>91) - acs366.phys.msu.su/ )

THE ROLE OF DEVELOPING NATION TOWARDS COMBATING THE CYBER CRIME Abhishek Vaish and Satya Prakash, Indian Institute of Information Technology, Allahabad. ... Highlights on the recent trends: A report of Indian computer Emergency Response Team (CERTIN) shows that more than 2500 incidents were registered and handled in the year 2008. ... Others security incidents reported in the year 2004 was 4, in the year 2005 was 18, in the year 2006 was 17, in the year 2007 was 264 and in the year 2008 was 94. ...

Еще в разделе: (Показать все результаты (>7) - www.iisi.msu.ru/ )

... Basic statement: "Mathematics is much clever, than Mathematician" It means, that after the scientist or engineer developed new mathematical model and designed corresponding equations, the solution to these equations produces new information unpredictable for the author! ... This vibration excites the shear wave in tissue 2 sx 2 - (ct + ) s x = Fx 2 t t Studies in Fluid Dynamics of water jet are connected with two main problems: 1. Flows in contracting nozzle forming high-speed jet. ...

Еще в разделе: (Показать все результаты (>40) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/links.htm
• http://acoustics.phys.msu.su/conference.htm

... Language English (en) Русский (ru) . Skip available courses . Управляющий: Алла Леонидовна Назаренко . ... Students will utilize Moodle, an online course management system, as they work to complete the project.љ ... The chief purpose of this courseљљ is to provide you with theoretical insights, practical skills, and ethical standards of the discipline of management with a focus on information management and human resources.љ ... Учитель: Оксана Малютина . ... English Language Courses . ...

Еще в разделе: (Показать все результаты (>10567) - moodle.ffl.msu.ru/ )

• Summary of ICT in Intercultural Communication
• Summary of Intercultural Communication in the Global Classroom
• moodle: Integrated course

... l - the mean galactic longitude; . ... mul - the median proper motion along galactic longitude of the stars of the OB-association, in units of 0.001 arcsec year -1 ; . dml - the estimation of mul dispersion in the OB-association, in 0.001 arcsec year -1 ; . mub - the median proper motion along galactic latitude of the stars of the OB-association, in units of 0.001 arcsec year -1 ; . dmb - the estimation of mub dispersion in the OB-association, in 0.001 arcsec year -1 ; . ...

Еще в разделе: (Показать все результаты (>186) - lnfm1.sai.msu.ru/ )

• Calibration data
• Edward Kononovich Homepage
• Manpage of FITSHDR

... Head of the laboratory of Magnetic Semiconductors. ... magnetic semiconductors, spin glasses, chalcogenide spinels, manganites, magnetic two-phase state. ... In antiferromagnetic (AF) semiconductors the ferrons can exist leading off T = 0 and in F semiconductors the ones can present in vicinity of Curie point. ... L.I. Koroleva "Antiferron states of charge carriers in the ferromagnetic semiconductors CuCr2S4-xSex (0.5?x?1.5) with Curie points above room temperature", JETP, 79, No 1, p. 153-162, 1994...

Еще в разделе: (Показать все результаты (>8) - ferro.phys.msu.ru/ )

• Laboratory of Ferroelectricity

... Land Hydrology . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Departments . ... Main accomplished research: River hydrology, limnology, hydrometry, water quality, flow hydraulics, hydrological predictions, fluvial processes, hydrophysics, hydrogeology, water management, water ecology. ... Large international conferences were organized by Hydrology Department for the last years – for example X Symposium on River Sedimentation (2007). ...

Еще в разделе: (Показать все результаты (>51) - eng.geogr.msu.ru/ )

• Department of Meteorology and Climatology
• Administration
• Complex Mapping

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>108) - imaging.cmc.msu.ru/ )

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>179) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee service