... I. The Essence of Systemology and its Concepts . 1.1 Primary Concepts of Systemology (The Logic of Systems) . ... 1.5 The Essence of the System, and the Foundations of its development and Determinants . The foundation, the essence, and the essential and "essence" properties of the system. ... Adaptivity and Reflection . ... Advanced Reflection. ... The Communicative Situation and the Communicative Act. ... Meaning, sense, the linguistic sign, the speech sign, the moneme, and natural language. ...

Еще в разделе: (Показать все результаты (>63) - old.philol.msu.ru/ )

• MSU-LGCLL:: Anatoliy A. Polikarpov - Some Factors and Regularities of

... Master Education . ... Master programs . ... graduates for activities requiring in-depth fundamental and professional knowledge, including research in applied mathematics and computer technology, development and use of mathematical models for processes and objects, development and application of advanced mathematical methods and software to address problems in science, technology, economics and management.The Mathematical and Computational Methods of Image Processing ... master thesis...

Еще в разделе: (Показать все результаты (>20) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• The core courses for the specialty "Applied Mathematics and Computer Science".
• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |

... Competition for image processing of printed circuit boards . ... 32-bit Microcontroller Programming . Microcontroller Control of Motors . Second-year students classes . ... Circuit Diagnostics . ... Microcontroller Programming . ... Microcontroller-related . ... 2014/2015 . ... Alexander Karabutov . ... Alexander Iovlev . ... Alexander Monahov . ... We sincerely wish you a Happy New Year and Merry Christmas! We hope that this year has been for you a year of new achievements. ... Print . ...

Еще в разделе: (Показать все результаты (>73) - engineering.phys.msu.ru/ )

• Circuit Diagnostics
• Meeting with the first course
• Introduction to Linux

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Department of Meteorology and Climatology
• Department of Land Hydrology
• THE MAKKAVEEV LABORATORY OF SOIL EROSION AND FLUVIAL PROCESSES

vkgris@mail.ru The opportunity of detection and diagnostics of nano-object parameters in matter by relativistic electrons x-ray radiation generated in an investigated object is discussed. Polarization bremsstrahlung radiation (PB) of relativistic electrons on matter electrons is considered. ... C60 (60)2 (!) ... Grishin V.K. Polarization radiation from relativistic electrons in matter containing fullerenes// Nuclear instruments and Methods in Physics Research B, 2005, v.227, N 1-2, 82-86. ...

Еще в разделе: (Показать все результаты (>147) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/1998_10.pdf
• http://nuclphys.sinp.msu.ru/nseminar/08_09_09.pdf
• http://nuclphys.sinp.msu.ru/persons/VEKSLER/veksler100/reports/reports/Toneev_100VIV.11.10.07.pdf

International Laser Center of MSU . ... News . ... Все новости . ... 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . ... Home News Наука . ... International Conference on Photo-Excited Processes and Applications. ... Другие новости категории: . ... 2015 5 Международная конференция по фотонике и информационной оптике . 4-6 февраля 2016 г. НИЯУ МИФИ, Москва Заявку желательно подать до 1 ноября 2015г. на сайте конференции. ... Категория: Конференции . ...

Еще в разделе: (Показать все результаты (>128) - ilc.phys.msu.ru/ )

• Laboratory of Nonlinear Spectroscopy of Ultrafast Processes in Condensed Matter
• Laboratory of ultrafast processes in biology

... О физическом факультете . ... Помощь факультету . ССО факультета . ... Система электронного документооборота (СЭД) МГУ . ... Физический факультет . ... Наш факультет . Новости факультета . История факультета . Подразделения факультета . Выпускники факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Научные семинары . ... Журнал "Ученые записки физического факультета МГУ" . ... Тема: 'Modeling and Control of Physiological Process: Towards Systems Medicine'. ...

Еще в разделе: (Показать все результаты (>177) - phys.msu.ru/ )

• "EURASIP Journal on Applied Signal Processing
• Title
• Гумбольдтовская лекция на физфаке

Mathematical modeling of biophysical processes in living cells and tissues . duration 6 months . ... 7(095) 939-26-12, Fax: +7(095)939-31-13, Email: romanov@yumr.phys.msu.ru . ... Interaction of femtosecond laser pulses with plasmas of modified targets . ... Theoretical investigations of polarization self-action and wave-interaction effects in nonlinear optics. ... Alexander V. Priezzhev, Associate Professor, Candidate of Sciences (physics and mathematics), Tel. ...

Еще в разделе: (Показать все результаты (>26) - foroff.phys.msu.ru/ )

• Postdoctoral training of foreign scientists at Physical Department

M obile A stronomical Sy stem of TE lescope- R obots MASTER-II Kislovodsk Lomonosov Moscow State University, Sternberg Astronomical Institute , Moscow Union "Optic" , Kislovodsk Solar Station Latitude = 43 o љ44'.767љN; Longitude = 42 o љ31'.417љE; Altitude = 2067љm MASTERљIIљ(8љsquareљdegress) + MASTERљVWF(VeryљWideљFieldљCameras (FOV=800 square degrees, Timeљresolutionљupљtoљ150љms, with unfiltered m_lim=14m on 5 sec. exposure, and ~10.5m with 0.15 sec) . ... 11h 38m 38.0s , -09d 59m 59s) . ...

Еще в разделе: (Показать все результаты (>2) - apollo.sai.msu.ru/ )

• Meteo :: Kislovodsk Database ::

... Make file etc. ... Model File 1 6 What is GRACE? ... Phys.Rev.D75, 113002('07) 15 GRACE for SUSY : Gauge Fixing Non-linear Gauge Fixing : S-leptons GF-S = 16 GRACE for SUSY : Renomarization Electro-weak corrections On-Mass-Shell scheme mass shifts for h0, H±, 0 2,3,4 only Sfermion sector 17 GRACE for SUSY : Renomarization QCD corrections 18 GRACE for SUSY : System Check Non-linear Gauge Check (One Phase Point) Ex. for One-Loop ~~ ~ ~~ ~ ~, , , , , , ) NLG Parameters : ( h H h H...

Еще в разделе: (Показать все результаты (>154) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf
• http://qfthep.sinp.msu.ru/talks/qfthep10_levchenko.pdf
• http://qfthep.sinp.msu.ru/talks2013/qfthep_anom_tW.pdf

... 1988) MERCURY Dollfus & Auriere(1974) Veverka et al. ... Lunar Crater name Ptolemaeus Bullialdus Gassendi crater maturity Im Is/FeO 1.452 68 1.451 68 1.415 75 Mercurian wavelength dependence of Pmax and lunar data 1,6 1 1,4 3 1,2 1 5 0,8 0,6 0,4 0,2 0 2,2 2,4 2,6 2,8 3 3,2 log l, (nm) Fig. 3 log Pmax, (%) 2 4 6 Conclusions: Maturity of the soil on the Mercurian surface in scale of whole disk is similar to space weathering of the soil in large old craters on the lunar highland. ...

Еще в разделе: (Показать все результаты (>83) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Rod/Publications/ms40/21_Dolitsky_etal.pdf
• http://selena.sai.msu.ru/Rod/Publications/ms38/ms015.pdf
• http://selena.sai.msu.ru/San/Publications/ms34/MS047.pdf

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... java - another question about Process . ... Re: java - another question about Process [ re: hml ] . ... Re: java - another question about Process [ re: shaller ] . ...

Еще в разделе: (Показать все результаты (>1306) - www.fds-net.ru/ )

• Ошибка Generic Host Process for Win32 Services - Public forum of MSU united
• System Idle Process - Public forum of MSU united student networks
• Sales managers! part-time job! work experience isn't crucial! - Public forum of

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>114) - cosmos.msu.ru/ )

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>16) - seac47-2.phys.msu.ru/ )

... 2 from allpy import dna . ... 6 def my_column_mark ( column , threshold ): . 7 """Helper to mark column (given as dict) by identity.""" . 8 count = {} . 9 for sequence , monomer in column : . ... 11 count [ code ] = count . ... 14 return "+" . ... 19 if column [ 0 ] is None or column [ 1 ] is None : . ... 25 def find_runs ( markup ): . ... 33 plus_positions = [] . ... 46 raise Exception ( "No blocks in alignment" ) . ... 66 for column in alignment . ... 68 markup = alignment . ...

Еще в разделе: (Показать все результаты (>17895) - kodomo.fbb.msu.ru/ )

• allpy: 56d62d405021 sandbox/wx-dc.py
• cca: a308291203ea Help/Help.html
• allpy: fedcd441e2fc sandbox/wx-dc.py

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>63) - brain.bio.msu.ru/ )

• Change-points in multi-channel EEG
• Analysis of change-point synchronization in multi-channel EEG
• Change-points in EEG components with different pattern

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/seminar/Yakovenko.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

. [ Войти ] . Главная -> Фильмы -> Process . Пользователи . Демо . Деньги . Фильмы . Форум . Process . Великобритания - Франция 2004 . отметить .

Еще в разделе: (Показать все результаты (>33) - kinfo.ru/ )