... All rights reserved finmen.spa@mail.ru : : hcp://spa.msu.ru/page_325.html : hcp://vk.com/mh_msu_fgu_finance .. ... All rights reserved / () · : · : LIBOR ( London Interbank Offered Pate), MIBOR ( Moscow Interbank Offered Pate) · :LIBID (London Interbank Bid), MIBID (Moscow Interbank Bid) · : MIACR (Moscow Interbank Ac·al Credit Rate) · : Prime- rate, Mosprime- rate .. ... All rights reserved · ­ , t i B ­ D =- - - - - - - - - - - - - - t - 360 i - , 100% · .. ... All rights reserved · , · APR ­ , . ...

Еще в разделе: (Показать все результаты (>31) - www.spa.msu.ru/ )

• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2702_finance_analysis.pdf
• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2002_finance_analysis.pdf

Еще в разделе: (Показать все результаты (>2) - termogaz.imec.msu.ru/ )

. People on #C4ACTbE as of 18 Jan 2001 18:45 MSK . Nickname . Status . User@Host . C4ACTbEP . idle . This is me, the channel bot. XAM[c] . idle . u0948@mvs.imm.uran.ru . Igorek . idle . igorek@kronos.psu.ru . Berendeev . - . graffity@ts16-a82.dial.sovam.com . Created by quesedilla v3 via eggdrop This page is automatically refreshed.

Еще в разделе: (Показать все результаты (>6) - asa.guru.ru/ )

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . You may download the latest source code distribution and install the period search service at your own web server. ...

Еще в разделе: (Показать все результаты (>3) - scan.sai.msu.ru/ )

• The NMW survey homepage

... This course focuses on main characteristics of the ?life? of academic information (its development and diffusion), and on basic algorithms of data retrieval. ... This course consists of four interrelated areas: theoretical introduction (Internetics and information theory), and practical units including the three pillars of information retrieval services: factual, bibliographic and documentary search. ... Factual search. ... Internet-heuristics strategies: summarizing information retrieval skills . ...

Еще в разделе: (Показать все результаты (>3379) - hist.msu.ru/ )

• The Founding of Moscow University
• Massaria Caffae 1374

... Thursday, April 19th, 2012 . ... Posted in Uncategorized | No Comments ? Friday, April 13th, 2012 . Обновлен раздел Публикации за 2011 . ... Сделать это можно использую Map Tools проекта SOPAC (http://sopac NULL .ucsd NULL .edu/maps/) . ... 17-21 октября 2011 в ИФЗ РАН прошла Вторая молодежная тектонофизическая школа-семинар (http://tph_2011 NULL .ifz NULL .ru/) , на котором наша лаборатория приняла участие. ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>41) - geo.sai.msu.ru/ )

• GAMIT Лаборатория лазерной интерферометрии
• Northern Lights over Norway Лаборатория лазерной интерферометрии
• February 2012 Лаборатория лазерной интерферометрии

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

... Summury: Usually a water column consists of two big layers. The upper layer (10-50 m deep) is characterized by strong mixing, as a result, both the biomass and nutrients are nearly uniformly distributed there. ... In this article we show that in the presence of an upper mixed layer (UML) there can be two stable vertical distributions of phytoplankton biomass: either the bulk of the biomass is located within the upper layer or below it. ...

Еще в разделе: (Показать все результаты (>77) - chaos.phys.msu.ru/ )

Moscow State University Belozersky Institute of Physico-Chemical Biology . Department of Electron Microscopy is a sub-division of A.N. Belozersky Institute of Physico-Chemical Biology . ... We are interested of how eukaryotic cell is organized, formed and functioned. Since A.N. Belozersky Institute of Physico-Chemical Biology is one of the scientific departments of Moscow State University ? ... Understanding the metaphase chromosome architecture remains a basic challenge in cell biology. ...

Еще в разделе: (Показать все результаты (>9) - cellbiol.genebee.msu.ru/ )

A method of stabilization by means of right-hand sides" . Kalinina A.B. The stabilization problem for unstable solutions of systems of ordinary differential equations by means of the right-hand sides is considered. ... Key words: stabilization methods, ordinary differential equations, unstable solutions . PostScript (in Russian) (144KB) . PDF (in Russian) (154KB) . PostScript. zip (in Russian) (46.7KB) . PDF. zip (in Russian) (66.6KB) . Kalinina A.B. e-mail: vokati@yandex.ru ...

Еще в разделе: (Показать все результаты (>202) - num-meth.srcc.msu.ru/ )

• Publication Alerts

Around Europe at almost the Speed of Light: Erasmus Mundus Europhotonics Key Data and Benefits 2-year Master of Science ( MSc ) Program Study at three excellent European universities in France, Germany Spain Prerequisite: Bachelor degree in engineering or natural sciences Multiple MSc degree possible Scholarships available Industry internship program Program Start: October each year Program Language: English Yearly spring ... Phone: +49 (0)721 608 47880 | ...

Еще в разделе: (Показать все результаты (>170) - phys.msu.ru/ )

• Публикации по истории факультета
• Задачи вступительных экзаменов

The Energy Spectrum of Primary Cosmic Rays by the Data of Tunka Cherenkov Array . S.V.Bryanski, Y.V.Vasilchenko, O.A.Gress, T.I.Gress, G.N.Dudkin, A.I.Klimov, V.S.Khlytchieva, L.A.Kuzmichev, B.K.Lubsandorzhiev, E.A.Osipova, V.N.Padalko, L.V.Pan'kov, Yu.A.Parfenov, P.G.Pochil, V.V.Prosin, Yu.A.Semeney . Proc. 24th ICRC, Roma, 1995, v.2, p.724 . The First Results of TUNKA-13 EAS Cherenkov Light Experiment . ... Tunka EAS Cherenkov Array - status 2001 . ... 1) SINP MSU, Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>25) - dbserv.sinp.msu.ru/ )

• TUNKA-25 EAS CHERENKOV LIGHT ARRAY

The first major global tomographic study was made by Professor Dziewonski in early 70's. The idea of this study was that the travel time anomalies observed for many ray paths, criss-crossing the Earth between various points near the Earth's surface and reaching different depths in its interior, could be resolved formally into a three-dimensional (3-D) model. ... How to use Harvard's 3-D Earth models? Now, you can download source codes in order to use Harvard's recent Earth models. ...

Еще в разделе: (Показать все результаты (>884) - geo.web.ru/ )

• Александр Розенбаум - "Спокойной ночи"
• Global Seismic Tomography
• Фонотека - Александр Быстрицкий. "Доктор в глубоких мыслях"

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>36) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf
• http://www.innovation.msu.ru/russian/methodsforfinancingfourcompany_rus.pdf

... In Vitro Demonstration of Dual Light-Driven Na(+)/H(+) Pumping by a Microbial Rhodopsin. ... A subfamily of rhodopsin pigments was recently discovered in bacteria and proposed to function as dual-function light-driven H(+)/Na(+) pumps, ejecting sodium ions from cells in the presence of sodium and protons in its absence. ... Therefore, an in vitro system consisting of the purified pigment in the absence of other proteins was needed to assign the putative Na(+) and H(+) transport definitively. ...

Еще в разделе: (Показать все результаты (>217) - biochem.bio.msu.ru/ )

• NEUROSCIENCE. Natural light-gated anion channels: A family of microbial
• Three-dimensional structure of alpha-crystallin domain dimers of human small
• Interaction of Hsp27 with native phosphorylase kinase under crowding...

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>1022) - kodomo.cmm.msu.ru/ )

• projects
• Term2
• Term3

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

... Since 2003 he studied in the subdepartment of Mathematical Theory of Intelligent Systems under the supervision of Prof. V.B.Kudryavtsev. ... In 2006 Dmitriy graduated with distinction from department of mathematics and continued his postgraduate studies in the subdepartment of Mathematical Theory of Intelligent Systems, where he did his research in Automata Theory. ... Dmitriy completely described the lattice of all clones of self-dual functions in three-valued logic. ...

Еще в разделе: (Показать все результаты (>87) - www.intsys.msu.ru/ )

• Game Rules
• Intelligent Systems :: Staff :: Nosov Valentin Alexandrovich :: History of
• Intelligent Systems :: Research :: :: Articles

. | . Full Text PDF (117 K) . | . Doklady Biochemistry and Biophysics . 382 (1-6): 26-30, January - February, 2002 . Copyright © 2002 MAIK “ Nauka/Interperiodica ” . All rights reserved . A. E. Serov . Faculty of Chemistry, Moscow State University, Vorob'evy gory, Moscow, 119899 Russia . A. S. Popova . Faculty of Chemistry, Moscow State University, Vorob'evy gory, Moscow, 119899 Russia . V. I. Tishkov . Faculty of Chemistry, Moscow State University, Vorob'evy gory, Moscow, 119899 Russia . Article ID: 372336

Еще в разделе: (Показать все результаты (>142) - www.enzyme.chem.msu.ru/ )

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50љnm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>163) - nanolab.phys.msu.ru/ )

• Daniil A. Shilkin | Laboratory of Nanophotonics & Metamaterials
• Frolov Aleksandr Yurievich | Laboratory of Nanophotonics & Metamaterials
• Okhlopkov Kirill Igorevich | Laboratory of Nanophotonics & Metamaterials