Neutrino quantum states and spin light in matter . ... 45 (1980) 942 Pal, L. Wolfenstein, Phys.Rev.D 25 (1982) 766 Giunti, C.W. Kim, W.P. Lam, Phys.Rev.D 43 (1991) 164 Neutrinos weak interaction with matter is taking into account: we use exact wave functions for the initial and final neutrinos in presence of matter is coupled to neutrinos by transition magnetic moment high density of matter (neutron stars) relativistic neutrinos Modified Dirac Equation for unpolarized and ...

Еще в разделе: (Показать все результаты (>180) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Braguta.pdf
• http://nuclphys.sinp.msu.ru/conf/dm/Petronzio_Piazzoli_wonderREV.pdf
• http://nuclphys.sinp.msu.ru/conf/epp10/Lukin.pdf

... research | ... Vladimir Alexeevich Kholodov . ... Dokuchaev Institute of Soil Science of Russian Academy of Agricultural Sciences, Moscow, Russia. ... Study at the Soil Science Department of Lomonosov Moscow State University. The diploma work "Toxicity of herbicides in soils of different types" was succesfully defended at the Chair of Agriculture, Soil Science Department. ... Post graduate student at the Division of Agriculture, Department of Soil Science, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>152) - mgumus.chem.msu.ru/ )

• MGUMUS -- Kirk Hatfield

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

... ДИМО' > Программные средства > Программа ДИМО Lights . ... Алгоритмы схемы ДИМО частично реализованы в программе ДИМО Lights . ... Для обеспечения максимальной гибкости настроек и облегчения анализа результатов, программа работает в непрерывном контакте с пакетом Microsoft Office Excel, который играет роль источника входных данных, хранилища промежуточных результатов и результатов моделирования. ... Входные данные алгоритмов берутся из текущей открытой книги Excel, согласно листу настроек. ...

Еще в разделе: (Показать все результаты (>9) - oc.cs.msu.su/ )

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>19) - comphep.sinp.msu.ru/ )

... Студенческая Астрономическая обсерватория ГАИШ . ... Любителям астрономии . История ГАИШ и Московской обсерватории . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... Welcome to the Extra-galactic research group of SAI ! ... Sternberg Astronomical Institute is older than the entire field of extra-galactic astronomy. ... At the same time, the Extra-galactic astronomy group as an element of the institute structure remains the youngest subdivision of SAI. ... 2007, astro-ph/0709.3047 . ...

Еще в разделе: (Показать все результаты (>24) - www.sai.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>162) - www.genebee.msu.ru/ )

• razjivin_dept
• AliGraf - GeneBee Graphical Alignment Help

... Acousto-Optic Cells with Non-Uniform Length of Light and Sound Interaction . ... The paper examines operation of acousto-optic cells designed with cross section of acoustic columns different from the traditional rectangular form. ... It is evident that application of the   transducers possessing the complicated shape of the electrodes results in unequal lengths of light and sound interaction over cross section of an incident optical beam. ... Section : 9 ...

Еще в разделе: (Показать все результаты (>236) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Light Allow : не работает регулятор яркости . ... Re: Light Allow : не работает регулятор яркости [ re: Sash ] . ... Re: Light Allow : не работает регулятор яркости [ re: iDvs ] ...

Еще в разделе: (Показать все результаты (>5948) - www.snto-msu.net/ )

• Детализация рейтинга: light - Public forum of MSU united student networks
• Lights Out - Public forum of MSU united student networks

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>43) - cdfe.sinp.msu.ru/ )

• CDFE => Online services => Chart of Nuclear Quadrupole Deformations
• EXFOR Search Engine
• CDFE => Online Services => Relational ENSDF

List of Publications . ... Odoulov S,Tarabrova T, Shumelyuk S, Naumova II, Chaplina TO: Photorefractive response of bulk periodically poled LiNbO 3 :Y:Fe at high and low spatial frequencies. ... Evlanova N.F., Naumova I.I., Chaplina T.O., Blokhin S.A. and Lavrishchev S.V. Periodically poled Y:LiNbO 3 single crystal: impurity distribution and domain wall location, Journal of Crystal Growth, Vol. 223, ? 1-2, pp 156-160 (2001). ... Phys. Rev. Lett., 86, pp 4021-402 (2001). ...

Еще в разделе: (Показать все результаты (>5) - newcryst.phys.msu.ru/ )

• Search of novel crystalline materials

... Scientific goals . ... Transient luminous events . ... Magnetospheric particles and radiation conditions . ... Scientific equipment . ... Current experimental data about the discharges in the upper atmosphere have shown that the phenomena of the discharges in the upper atmosphere is of global character, a number of the discharges and the energy separated in this discharges are so high that we can expect certain relations between the discharge phenomena and other geophysical phenomena. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• Mikhail Lomonosov ? the Pioneer of Russian Science | Университетский спутник
• Scientific goals | Университетский спутник "Ломоносов"
• Publications | Университетский спутник "Ломоносов"

Visualization of diffraction effects in the design of computer-generated holograms" . ... We consider a method for visualization of diffraction patterns arising in the cases when compound computer-generated holograms with diffraction gratings of various parameters are illuminated by white light. The method allows us to obtain real-time colored pictures of holograms when the light source and an observer move relative to each other. ... PostScript (in Russian) (378KB) . ...

Еще в разделе: (Показать все результаты (>165) - num-meth.srcc.msu.ru/ )

• Publication Ethics and Publication Malpractice Statement
• Publication Alerts

... Bashindzhagyan G . ... Panasyuk M . ... Proc.26th ICRC, Salt Lake City , 1999, v.5, p.132-135. Bashindzhagyan G.L., Samsonov G.A., Khein L.A., Panasyuk M.I., . Voronin A.G., Zatsepin V.I., ATIC Collab .. The Advanced Thin Ionization Calorimeter (ATIC) for Studies of High . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.9-12. ... Silicon Matrix Detector for ATIC . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.453-456. ... Advanced Thin Ionization Calorimeter (ATIC) .- ...

Еще в разделе: (Показать все результаты (>26) - silab.sinp.msu.ru/ )

... Anisotropy effects investigations by resistivity method. ... I.N.Modin. ... Pervago E.V., Bobachev A.A., Modin I.N., Shevnin V.A. Report, presented at Annual SAGEEP conference, April 1995, Orlando, Florida, USA. 1 p. RESISTIVITY PROSPECTING IN URBAN REGIONS . ... Bobachev A.A., Modin I.N., Pervago E.V.Proceedings of 5th EEGS-ES Meeting in Budapest, Hungary, September 1999. ... Bobachev A.A. Modin I.N., Pervago E.V., Shevnin V.A.Proceedings of 5th EEGS-ES Meeting in Budapest, Hungary, September 1999....

Еще в разделе: (Показать все результаты (>61) - geophys.geol.msu.ru/ )

• Page 2
• Near-surface electrical prospecting laboratory at Moscow University

... Electromagnetic nature of light precursors of earthquakes / Natyaganov V.L. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>45) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Правила

... Russian: ps 2 pages . Published in: Russian Math. Surveys 57 (2002), no.3. ... English: ps (gzipped) 41 pages . ... Finitely presented groups and semigroups in knot theory. Russian: ps (gzipped) tex . English: ps (gzipped) tex . ... Russian: ps (gzipped) English: ps 20 pages . arXiv.org e-Print archive: http://arXiv.org/abs/math.RA/0205042 . ... Russian: ps English: ps 11 pages . ... In this paper we introduce and study gauge-equivariant $K$-theory groups $K_\GR^i(Y)$. ...

Еще в разделе: (Показать все результаты (>139) - higeom.math.msu.su/ )

• Alexey Garber
• Publications (Russian)
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1971

hide all show ribbon, chain A+D color white, all select contactzone, chain a and (chain d around 5.5) show surface, contactzone set transparency, 0.2 remove chain D set surface_color , yellow , A/49/CB set surface_color , yellow , D/114/CG set surface_color , yellow , D/114/CD set surface_color , yellow , D/114/CB set surface_color , yellow , D/93/ CD1 set surface_color , ...

Еще в разделе: (Показать все результаты (>9835) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/hg/allpy/raw-rev/b5a5f46a48a7
• allpy: bd3d695f9906
• allpy: bd3d695f9906 sandbox/common.py

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>7) - lab106.imec.msu.ru/ )

. elstream.ru: онлайн видеотрансляции с Эльбруса . GAMIT . Tags: видео . This entry was posted on Saturday, January 28th, 2012 at 10:12 am and is filed under Uncategorized . You can follow any responses to this entry through the RSS 2.0 feed. Responses are currently closed, but you can trackback from your own site. Comments are closed. Лаборатория лазерной интерферометрии is proudly powered by WordPress . Entries (RSS) and Comments (RSS) .

Еще в разделе: (Показать все результаты (>5) - geo.sai.msu.ru/ )

• January 2012 Лаборатория лазерной интерферометрии
• Uncategorized Лаборатория лазерной интерферометрии