... Chemistry of Coordination Compounds . ... Inorganic Synthesis . ... CLUSTERS AND EXTENDED METAL-METAL BOND SYSTEMS IN INORGANIC COMPOUNDS . ... Cluster compounds, structure & bonding, quantum chemistry . ... Inorganic synthesis, bismuth clusters, metal subhalides . ... inorganic synthesis, clusters, mixed chalcogenides . ... Design, synthesis and investigations of inorganic compounds featuring extended systems of homo- and heterometallic bonds of varying (1D, 2D) dimensionality. ... Kuznetsov . ...

Еще в разделе: (Показать все результаты (>113) - www.inorg.chem.msu.ru/ )

• Prof. Dolgikh group. Publications 2002
• Prof. Dolgikh group. Publications 2003
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... 1621, 2015 April 20 Conrmation of Pulsed Radio Emission from the Pulsar J1907+0919 (Shitov Radio Pulsar, SGR 1900+14) A.P. Glushak, B.Ya. ... Observations at a frequency of 111 MHz with the Large Phased Array at the Pushchino Radio Astronomy Observatory of the Astro Space Center of the P.N. Leb edev Physical Institute conrm the pulsed radio emission of the X-ray pulsar J1907+0919 that is a counterpart of the magnetar SGR 1900+14. ... The average p erio dogram of PSR J1907+0919 is shown in Fig. ...

Еще в разделе: (Показать все результаты (>118) - comet.sai.msu.ru/ )

• Network domains and mail addresses
• Astronomical Circular - Contents
• Previous and Proposed

... Proceedings 2009 . ... It is discussed the active centre model of the polynucleus enzyme-ferredoxin, containing four iron ions (Fe (II)), surrounded with sulfur ions. ... According to this model the iron ion Fe (II) is in tetrahedral complex of weak ligand field. Iron ion gives vacant orbits for unshared electron pairs of the ligand sulfur ions. The ferredoxin functional mechanism may be explained with unpaired electron leaving of the cluster molecular orbit e* (transition Fe (II) - Fe (III)). ...

Еще в разделе: (Показать все результаты (>13837) - www.mce.biophys.msu.ru/ )

• Modeling of the processes connected to nucleon cluster effects

... Initiation of Destructive Strike Acoustic Wave in the Liquid of the Big Volume at the Temperature Near to Boiling Point . ... Let, in the closed reservoir not completely filled by liquid at the temperature near to boiling point, the pressure decreases quickly. Here, the temperature of liquid boiling decreases also quickly and if it is less than original liquid temperature, the part of the internal energy will be expended for vapor formation. ...

Еще в разделе: (Показать все результаты (>143) - acs366.phys.msu.su/ )

• ISNA-16

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>3501) - www.fds-net.ru/ )

• У кого есть Sims hot date или Livin'large или еще что-нибудь?? - Public forum
• зачем эволюции капризность женского организма? - Public forum of MSU united
• Серьезные картинки - Public forum of MSU united student networks

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>1745) - www.snto-msu.net/ )

• зачем эволюции капризность женского организма? - Public forum of MSU united

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>131) - qi.phys.msu.ru/ )

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>5) - www.dubinushka.ru/ )

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>24) - eco.soil.msu.ru/ )

• Polluting metals in Russian terrestrial ecosystems: chemistry, dynamics, and

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>275) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/4_11.pdf

... Ph.D. in Physics and Mathematics (Theoretical and Computational Chemistry), Department of Chemistry, M.V.Lomonosov Moscow State University . M. Sc. in Chemistry, Department of Chemistry, M. V. Lomonosov Moscow State University (2000), Thesis: "Ab initio study of equilibrium structures and vibrational spectra of molecular clusters". ... Undergraduate Student, Department of Chemistry, M. V. Lomonosov Moscow State University (1995-2000). ... Quantum and Computational Chemistry; . ... autumn 2001. ...

Еще в разделе: (Показать все результаты (>21) - lcc.chem.msu.ru/ )

• Current Projects
• History
• Alexander A. Moskovsky homepage

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>1578) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-2.pdf

... Introduction: In the present work the morphometric parameters for 87 large martian craters [1](with diameters from 411 up to 110 kms) have been determined: depth of a crater, the relation of depth of a crater to diameter (/D), height of a rim ­ h, with the help of profiles constructed on the basis of supervision of space vehicle MGS [2].The comparison with similar morphometric parameters of large lunar craters also is fulfiled. ... 2000) Morphological Calague Of the Craters Of Mars. ...

Еще в разделе: (Показать все результаты (>108) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Chik/Publications/Aitken/MS015.pdf
• http://selena.sai.msu.ru/Symposium/ant.pdf
• http://selena.sai.msu.ru/Symposium/ant.doc

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>930) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>18) - www.ecocoop.ru/ )

• For three and half years of activity the participants of Ecological Cooperation

... This is my main interest in linguistics that I have been pursuing for a number of years. ... Spoken language . Present-day linguistics is primarily oriented towards written language. ... I am personally interested in the latter kind of research since I prefer to use first-hand knowledge rather that crucially rely on how other people interpret languages (or still other people?s writings). ... This is one of the major languages of Russia spoken by dozens of thousands of people. ...

Еще в разделе: (Показать все результаты (>344) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/cv.html

LABORATORY . ... It was founded by two young Candidates of Philology who had just got their scientific degrees Boris Andreevich Uspensky and Vladislav Mitrofanovich Andruschenko as interdepartmental laboratory based on three departments: the English Language Department of the Philological Faculty, Foreign Languages Department for the Humanities and Arabic Department of the Institute for Asia and Africa. ... Vladislav Mitrofanovich Andruschenko was at the Head of the Laboratory from 1964 till 1983. ...

Еще в разделе: (Показать все результаты (>64) - lcl.srcc.msu.ru/ )

... Rank algorithms are well-known approach to image enhancement, denoising, and some other applications. ... Fast rank algorithms in use, image size 250x250 pixels: . ... Image with added Gaussian noise . ... Fast Rank Algorithms Based on Multiscale Histograms and Lazy Calculations // Pattern Recognition and Image Analysis , Vol. ... Fast Rank Algorithms with Multiscale Histograms Lazy Updating // In: 8th Open German-Russian Workshop Pattern Recognition and Image Understanding (OGRW-8-2011) . ...

Еще в разделе: (Показать все результаты (>831) - imaging.cmc.msu.ru/ )

• View publication | Laboratory of Mathematical Methods of Image Processing
• Publications | Laboratory of Mathematical Methods of Image Processing

Literature . ... Computers and Statistical Data Analysis. ... In Russian. ... Basic notions and methods of applied statistical analysis and usage of leading Russian and American statistical software tools: STADIA, STATGRAPHICS. ... The second edition has much more detailed depiction of temporal series analysis methods, review of statistical packages for Windows and recommendations on their choosing. ... Kulaichev A.P. Data Analysis Methods And Tools for Windows . ... In English and In Russian. ...

Еще в разделе: (Показать все результаты (>2) - statsoft.msu.ru/ )

• InCo Products Page In English

Alexander M. Kuznetsov . ... Sasha Kuznetsov entered a famous Theoretical Department of the Institute of Electrochemistry AN USSR in 1961, and joined Prof. R.R.Dogonadze group, They pioneered the quantum mechanical theory of electron transfer in solutions, which now became a general theory of in chemical, electrochemical and biological systems. ... Concludingly A.M. Kuznetsov is one of the pioneers and creators of quantum mechanical theory of charge transfer processes in condensed media. ...

Еще в разделе: (Показать все результаты (>99) - electr003.chem.msu.ru/ )