... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

... 5 -- () 2009 , 4 / 11 { int Min ( int a, int b) } i f (a < b) return else return a; b; a) { a; } { d o u b l e Cube ( d o u b l e return a * a * int main ( ) c o u t << c o u t << system ( " 0 } return M i n ( 1 , 2 ) << e n d l ; C u b e ( 3 . ... 5 -- () 2009 , 5 / 11 bool { } { x 1 = (- b - s q r t ( D ) ) / ( 2 * a ) ; x 2 = (- b + s q r t ( D ) ) / ( 2 * a ) ; ; Root2 ( double a , double b , double d o u b l e &x 1 , d o u b l e &x 2 ) double D = b * b - 4 * a * c ; i f (D < 0 . ...

Еще в разделе: (Показать все результаты (>17) - ani.cmc.msu.ru/ )

• http://ani.cmc.msu.ru/files/geo-2009-prac-01.pdf
• http://ani.cmc.msu.ru/files/geo-2009-prac-04.pdf

... This presentation is licensed for use under the terms of the Globus Toolkit Public License. ... Setting the Foundation l Strategies for the Globus Toolkit ­ Layered architecture, protocols APIs l Naming conventions ­ Functions, variables, structures, etc. l Installation tree structure ­ Where things get installed l Source tree structure ­ Where things come from March 25, 2002 Globus ToolkitTM Developer Tutorial : Basics 2 ...

Еще в разделе: (Показать все результаты (>63) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-08-Information1.pdf
• http://acat02.sinp.msu.ru/presentations/brun/Solutions_2.doc

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>23) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf
• http://curl.sai.msu.ru/mass/download/doc/eso_details.pdf

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>139) - bioinf.fbb.msu.ru/ )

• RNA kinetics server
• User's guide
• SDPsite - Gallery of examples

О лаборатории . ... Лаборатория теоретической биофизики . ... Plotting bifurcation diagram of the following map using pylab . ... Нет комментариев " plotting bifurcation diagram with pylab " . ... Building and plotting Fukui function with FireFly and PyMol . ... Quantum? in Building and plotting Fukui functio? ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>29) - erg.biophys.msu.ru/ )

• Constructing discrete Laplacian via sparse matrix ERG Research Group:
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• Normal modes visualization for PyMol ERG Research Group: Лаборатория

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

... The given course consisting of lectures and seminars is aimed at teaching our students a whole range of measures, which allow quick and efficient faultfinding, functional testing, reliability testing of a device, find replacement for a faulty component at the modern technological level, fix a device, create a similar device even without the blueprints. ... Programming an unknown board on TestVue Software . ... Functional testing of an unknown board; comparison with the pattern . ...

Еще в разделе: (Показать все результаты (>19) - engineering.phys.msu.ru/ )

• Parallel Programming
• Beginning of the classes
• Introduction to Linux

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>161) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks2013/V._Kovalenko__Saint_Petersburg_State_University_.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435258212_Krutov_Polezhaev_Troitsky1_2015.pdf

... Abstract Description of the whole sorption preconcentration step was proposed based on a system of equations comprising equations of mass balance, external diffusion mass transfer and equilibrium distribution of analyte. ... Moscow University Chemistry Bulletin . 2009, Vol. ... 4, P. 238 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>445) - chem.msu.ru/ )

• Exciplexes on INTERNET
• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)
• Moscow University Chemistry Bulletin Vol. 47, No. 6, P. 377 (2006)

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>288) - higeom.math.msu.su/ )

• C*-algebras: Talks
• C*-algebras and elliptic theory
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/2008

V. V. KOZLOV Department of Mechanics and Mathematics Moscow State University, Vorob'ievy Gory 119899, Moscow, Russia E-mail: vako@mech.math.msu.su KINETICS OF COLLISIONLESS CONTINUOUS MEDIUM Received June 8, 2001 DOI: 10.1070/RD2001v006n03ABEH000175 In this article we develop Poincarґ ideas about a heat balance of ideal gas considered as a collisionless continuous medium. e We obtain the theorems on diffusion in nondegenerate completely integrable systems. ... d3 2 2 For the Maxwell distribution = 1. ...

Еще в разделе: (Показать все результаты (>142) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/268/pu_58_1220.pdf
• http://ics.org.ru/upload/iblock/c59/137-billiards-invariant-measures-and-equilibrium-thermodynamics-ii_ru.pdf
• http://ics.org.ru/upload/iblock/4bf/191-the-bifurcation-analysis-and-the-conley-index-in-mechanics_ru.pdf

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>20) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

Application of the Quickhull algorithm's principles to the double description method" . Bastrakov S.I., Zolotykh N.Yu. The double description method known also as the Motzkin-Burger algorithm is a method for computing the general solution of a system of linear inequalities. ... The numerical results demonstrate a number of advantages of the proposed modification over the original double description method and (in many cases) over the Quickhull algorithm. ... PostScript (in Russian) (1.51MB) . ...

Еще в разделе: (Показать все результаты (>289) - num-meth.srcc.msu.ru/ )

• "TreeDL: a language for description of graph structures and operations on them"
• "Automatic detection and description of supercomputer network infrastructure"
• "Implementation of the Lagrangian approach to the description of gas-particle

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>6) - lvk.cs.msu.su/ )

... In this paper we present a technique for authorship attribution based on a simple Markov chain of letters (i.e., just letter bigrams are used). ... We show that this technique provides excellent results when applied to over 380 texts from the Project Gutenberg archives, as well as to two previously published data sets. ... They examine the proportion of function words used by an author, and find that this is stable for each author, across a large number of writers in Russian. ... One Text . ...

Еще в разделе: (Показать все результаты (>48) - old.philol.msu.ru/ )

• Using Literal and Grammatical Statistics\\ for Authorship Attribution
• MSU-LGCLL:: O.V. Kukushkina, A.A. Polikarpov, D.V. Khmelev - Authorship
• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics

... 1 : -1); } function global_depth($f) { $flds = _read('folders.dat'); if ($f == '') return 0; $j = $f; $d = 0; while ($flds[$j]['parent'] != '') { $j = $flds[$j]['parent']; $d++; } return $d + 1; } function fext($url) { return strtolower(substr($url, strrpos($url, '.')+1)); } function global_drawfile($id) // { global $lang; $dscs = _read('files.dat'); // global $lang; if (isset($dscs[$id])) { $s = ' . ... lang=='en'?date('Y/m/d h:i A', $dscs[$id]['time']):date('d.m.Y H:i', $dscs[$id]['time'])).' ...

80. http://num-anal.srcc.msu.su/meth_mat/prac_alg/arfil/symc1.txt